SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000028487 from Gorilla gorilla 69_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000028487
Domain Number 1 Region: 313-558
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.6e-89
Family Eukaryotic proteases 0.0000347
Further Details:      
 
Domain Number 2 Region: 223-319
Classification Level Classification E-value
Superfamily SRCR-like 2.09e-18
Family Hepsin, N-terminal domain 0.022
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000028487
Domain Number - Region: 202-226
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000127
Family LDL receptor-like module 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000028487   Gene: ENSGGOG00000002744   Transcript: ENSGGOT00000026278
Sequence length 585
Comment pep:novel chromosome:gorGor3.1:11:115834987:115853362:-1 gene:ENSGGOG00000002744 transcript:ENSGGOT00000026278 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ETNRHGNASPARTPSAGASPAQASAAGTPPGRASPAQASPAQASPAGTPLGRASPAQASP
AGTPPGRASPAQASPAQASPAQASPARASPALASPSRSSSGRSSSARSASVTTSPTRVYL
VRATPVGAVPVRSSPARSAPATRATRESPGTSLPKFTWREGQKRLPLIGCVLLLIALVVS
LIILFQFWRDQTGIRYKEQRESCPKHAVRCDGVVDCKLKSDELGCVRFDWDKSLLKIYSG
SSHQWLPICSSNWNDSYSEKTCQQLGFESAYRTTEVAHRDFANSFSILRYNSTIQESLHR
SECPSQRYISLQCSHCGLRAMTGRIVGGALASDSKWPWQVSLHFGTTHICGGTLIDAQWV
LTAAHCFFVTREKVLEGWKVYAGTSNLNQLPEAASIAEIIINSNYTDEEDDYDIALMRLS
KPLTLSAHIHPACLPMHGQTFSLNETCWITGFGKTRETDDKTSPFLREVQVNLIDFKKCN
DYLVYDSYLTPRMMCAGDLRGGRDSCQGDSGGPLVCEQNNRWYLAGVTSWGTGCGQRNKP
GVYTKVTEVLPWIYSKMEVRSLQQDTAPSRLGTSSGGDPGGARRV
Download sequence
Identical sequences ENSGGOP00000028487 ENSGGOP00000002708

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]