SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384510254|ref|YP_005689832.1| from Corynebacterium pseudotuberculosis PAT10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384510254|ref|YP_005689832.1|
Domain Number 1 Region: 41-385
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.26e-54
Family Phosphate binding protein-like 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|384510254|ref|YP_005689832.1|
Sequence length 415
Comment Maltotriose-binding protein [Corynebacterium pseudotuberculosis PAT10]
Sequence
MKIHAKKALSVLAISTLVLAGCSSDKDSKGANGSGDSKGGKITLSVWSSQEDQDGSDGWL
QSVEKKFEEAHPDYDITWKNSVVGADQAATTVNQDPSAAADVYVYANDRLGSLLDSGSVG
ELSDASMKQLSEQAEDTIAASVKGQDGKAYGLPIEPNTWFMYYNKAKLNQEDIKSFDTML
SKAKVSFPMSNSWYYPAFYAGAGASFFGKDGLDEKAGIKLGDKAGEVTKYLTSVVKNPNF
VNDSEGSGIGGLANGSVDVVFSGSWDAKNIKKALGDNYGVASLPTFKLDGQDVQMKAFSG
SKAIAYNPNTKNPKAASEFAAFLASTESQKSHFDKNGVIPADKSLAKDAAIAADPVAVAL
FETVSNASILQPTLKPMTDFWDPATTFGKALVNGEVNSENAVAKTDAWTSSFSKK
Download sequence
Identical sequences D9QEE9
gi|384506070|ref|YP_005682739.1| gi|375287960|ref|YP_005122501.1| gi|384510254|ref|YP_005689832.1| gi|387137987|ref|YP_005693966.1| gi|383313561|ref|YP_005374416.1| gi|385806828|ref|YP_005843225.1| gi|389849733|ref|YP_006351968.1| gi|300857792|ref|YP_003782775.1| gi|384508160|ref|YP_005684828.1| WP_013241232.1.10260 WP_013241232.1.13534 WP_013241232.1.1517 WP_013241232.1.17000 WP_013241232.1.23262 WP_013241232.1.26120 WP_013241232.1.27158 WP_013241232.1.27718 WP_013241232.1.27807 WP_013241232.1.36079 WP_013241232.1.40652 WP_013241232.1.53184 WP_013241232.1.55662 WP_013241232.1.59640 WP_013241232.1.70614 WP_013241232.1.71708 WP_013241232.1.7404 WP_013241232.1.78842 WP_013241232.1.81362 WP_013241232.1.90433 WP_013241232.1.90599 WP_013241232.1.92600 WP_013241232.1.94788 WP_013241232.1.95330 gi|387135926|ref|YP_005691906.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]