SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384510312|ref|YP_005689890.1| from Corynebacterium pseudotuberculosis PAT10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384510312|ref|YP_005689890.1|
Domain Number 1 Region: 32-280
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 8.84e-66
Family Phosphate binding protein-like 0.0000172
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|384510312|ref|YP_005689890.1|
Sequence length 285
Comment D-methionine-binding lipoprotein metQ [Corynebacterium pseudotuberculosis PAT10]
Sequence
MNIRHSIATIAAAAIAATGLVACSSDRIDDSVRIGTTDSTKKAWTVWKDKAAEAGIALDV
VEFSDFSTPNQALSQNQLDVNLFQHLKFLAEYNVKSGSDLVPVGSTEIIPLALFWKGHDS
LDGIEGNSVAIPNDPTNQARALNVLVAAGLLKLKDGSPDLPAPADIDKEQSKVSVTPVEA
ASAPAAYGEGKPAVINNTFLDRAGIDAKTTIFQDDPSSAESEPYINVLVAKKENKDDPRW
QKLIELWHTPEVQDALAEDSKGTSVEVKRSPEELQQILDRLQKQS
Download sequence
Identical sequences D9QEK5
gi|384508218|ref|YP_005684886.1| gi|387135981|ref|YP_005691961.1| gi|384504038|ref|YP_005680708.1| gi|383313618|ref|YP_005374473.1| gi|384506128|ref|YP_005682797.1| gi|375288019|ref|YP_005122560.1| gi|300857856|ref|YP_003782839.1| gi|385806889|ref|YP_005843286.1| gi|384510312|ref|YP_005689890.1| WP_013241295.1.10990 WP_013241295.1.1517 WP_013241295.1.15940 WP_013241295.1.17000 WP_013241295.1.18294 WP_013241295.1.24230 WP_013241295.1.25418 WP_013241295.1.26120 WP_013241295.1.27158 WP_013241295.1.27593 WP_013241295.1.27718 WP_013241295.1.28798 WP_013241295.1.28877 WP_013241295.1.34597 WP_013241295.1.36079 WP_013241295.1.40652 WP_013241295.1.46769 WP_013241295.1.47148 WP_013241295.1.53184 WP_013241295.1.55662 WP_013241295.1.58055 WP_013241295.1.59640 WP_013241295.1.70614 WP_013241295.1.71708 WP_013241295.1.72847 WP_013241295.1.7404 WP_013241295.1.780 WP_013241295.1.78842 WP_013241295.1.79363 WP_013241295.1.81362 WP_013241295.1.90433 WP_013241295.1.90599 WP_013241295.1.92600 WP_013241295.1.94788 WP_013241295.1.95330 WP_013241295.1.96532 WP_013241295.1.97212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]