SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384511579|ref|YP_005691157.1| from Corynebacterium pseudotuberculosis PAT10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384511579|ref|YP_005691157.1|
Domain Number 1 Region: 51-368
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.56e-81
Family Phosphate binding protein-like 0.0000421
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|384511579|ref|YP_005691157.1|
Sequence length 368
Comment phosphate ABC transporter substrate-binding protein PstS [Corynebacterium pseudotuberculosis PAT10]
Sequence
MNLNLKRSTTALSIVCMGAVALSACSETSSSSGAGASTSEVSGLNKVGGELVGEGASSQQ
NAMDYFNIKYQEAVSGASLAYTASGSGSGRKNFIAGQVAFGGSDSPLSAEQVEKAKGRCQ
GNDAWHLPFVIGPVAVAYHLNGVDHLNLSAATVAKIFKGEIKKWNDAAIAQENTGVQLPD
SDIKVVYRSDESGTSDNFQKFLKAASPENWSTEGQAFPTAVGSGANGSNGVATEVSNIDG
AITYVEAGFAKQQKLGIAAIDFGHGPVQLNPDSVGVALDHLTFKTQGNDMVVDSSALFAM
KEKDAYPLILTTYEIVCSAGYDQTTRDRVKDFLSVALNSQDQELADLGYIPVKGTHRDRL
EKAVKAIS
Download sequence
Identical sequences WP_014522759.1.81362 WP_014522759.1.94788 gi|384511579|ref|YP_005691157.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]