SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|336325676|ref|YP_004605642.1| from Corynebacterium resistens DSM 45100

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|336325676|ref|YP_004605642.1|
Domain Number 1 Region: 155-336,460-630
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 4.98e-101
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000000856
Further Details:      
 
Domain Number 2 Region: 333-455
Classification Level Classification E-value
Superfamily GAD domain-like 1.26e-34
Family GAD domain 0.00057
Further Details:      
 
Domain Number 3 Region: 43-145
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.86e-30
Family Anticodon-binding domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|336325676|ref|YP_004605642.1|
Sequence length 637
Comment Aspartyl-tRNA synthetase [Corynebacterium resistens DSM 45100]
Sequence
MASSQKRDSSRSGHGVCSDLWKRCGKLRGRLHPKRKRNVTNVLRTHLAGELRPENIGQEV
TLTGWVGRRRDHGGVIFIDMRDRSGVAQVVFRESEVAERAHDLRSEYCIKVTGVVEARPE
GSENPNLPSGGIEVNVTDLEVLNASAALPFQIDDPSSAGEVGEETRLKYRYLDLRRKAQG
DALRLRSKVNAAARGVLARHDFTEIETPTLTRSTPEGARDFLVPARLKPGTFYALPQSPQ
LFKQLLMVAGMERYYQIARCYRDEDFRADRQPEFTQLDVEMSFVDQEDVIALAEEILVAI
WKEIGYEISTPIPRMTYADAMRLYGSDKPDLRFDIQITECTEFFKDTTFRVFQNEYVGAV
VMEGGASQPRRQLDAWQEWAKQRGAKGLAYILVGEDGELSGPVAKNITDAERAGIANHVG
AKPGDCIFFAAGDTKSSRALLGAARGEIAEKLGLIKEGDWAFTWVVDAPLFEPAADATAS
GDVALGNSAWTAVHHAFTSPKPEYLDTFDEDPGSALAYAYDIVCNGNEIGGGSIRIHRHD
IQERVFKVMGISEEEAREKFGFLLDAFAFGAPPHGGIAFGWDRIVSLLGGFSSIRDVIAF
PKSGGGVDPLTDAPGEISAAQRKESGIDFKPKAKAQQ
Download sequence
Identical sequences F8E318
gi|336325676|ref|YP_004605642.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]