SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|336325741|ref|YP_004605707.1| from Corynebacterium resistens DSM 45100

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|336325741|ref|YP_004605707.1|
Domain Number 1 Region: 55-300
Classification Level Classification E-value
Superfamily Cgl1923-like 4.05e-75
Family Cgl1923-like 0.00000023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|336325741|ref|YP_004605707.1|
Sequence length 380
Comment proteasome assembly chaperone [Corynebacterium resistens DSM 45100]
Sequence
MPENFSQPNGQHSPLYDLAYPNPLTGHTPALEPSVTNHSESAPQADTSDSATPTMPMMVA
LQGYADAGQAVHNAGIHILQALENQPVAKFRVDDLMDYRSRRPGVTMDHSRVVDREELTL
SLDVVTDTNGQQFLLLSGPEPDLKWGAFSDAVLELARKFNVDRVVTLYAAPMTVPHTRPL
VIAAHSTNHQLTTDYHTWDSRMIVPGAAALETELKLSRHGFETVGFTAHVPHYIAASDYP
EATHNLLQAVGDVTGRRLPLSALEADIARVQNQLAEQVEESAEIGAVVQALEQQYDANAE
RVRRRKENTLLRPGQTMPTGEEIGAELEAFLANVARGDAEVPHEANSMEDTGQHESTGGS
HEESGSDERRDDGDADSSKR
Download sequence
Identical sequences F8DXY5
gi|336325741|ref|YP_004605707.1| WP_013888556.1.72862

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]