SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|336326185|ref|YP_004606151.1| from Corynebacterium resistens DSM 45100

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|336326185|ref|YP_004606151.1|
Domain Number 1 Region: 69-573
Classification Level Classification E-value
Superfamily Heme-dependent catalase-like 1.44e-199
Family Heme-dependent catalases 0.000000000155
Further Details:      
 
Weak hits

Sequence:  gi|336326185|ref|YP_004606151.1|
Domain Number - Region: 596-692
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 0.00298
Family Catalase, C-terminal domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|336326185|ref|YP_004606151.1|
Sequence length 741
Comment catalase [Corynebacterium resistens DSM 45100]
Sequence
MGSTTPSSKDNEKNIDTTGIAPAPSGHTPELEEPTTPVDPPAANPDQGSPELRSATGCPF
HIGAGDPDPRHQQGSYLTNSQGARYTTSDHSLRAGERGPVLIQDQQLRDKLQHFDHERIP
ERVVHARGAGAHGTFVSNGKGAEICRAKVFDKGEETPVFVRFSTVAGFRGSMDTARDTRG
FATKFYTTEGNWDLVGNNIPVFFIQDGIKFPDVVHSVKPEPDLEIPQAQSAHDTFWDFVT
LHTEATHHTMWNMSDRGIPRSLRMMEGFGVHTFRVTNQEGKTHLVKFHWKPRLGVHSLVW
EEAQLTGGFDPDFHRRDLSDAIKAGAYPEWDLGVQVFEDTEDEMFEGIDLLDPTKLVPEE
LAPVTILGTMTLNANPTNYFAETEQATFHPGVLPPGINVTADPLLQGRLFSYSDTQLNRL
GGPNHGQLPINRPRTEVNDNQRDGRAQQAIHAGKTAYTPNSLEANNPLPAPEQFTRLDDG
KGALVDPEVTIAKSTQTRRKPVSFEDHFSQPALFYRSLTETEQQHIISAYTFELSKCYEE
PIRQRAVDVLARVDRGLANAVAAGLGLEVSQDVPAEVEKVETSPALSQLGKTYPVDGRKV
AILVDDATPAETVQAAVKAIVDAGMAPLVTTTTGGTLKPSDAGAQALPVSRTYSAARSIE
FDAAIVVALPDTPETNTLIEELTRHFKAIAVLDSIKPAEGQHALRKLVDNNPAGVKLVAD
AKAGVDALIPLLENHRVWDRA
Download sequence
Identical sequences F8E0J7
WP_013888975.1.72862 gi|336326185|ref|YP_004606151.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]