SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCHOP00000008264 from Choloepus hoffmanni 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCHOP00000008264
Domain Number 1 Region: 27-135
Classification Level Classification E-value
Superfamily CutC-like 4.58e-33
Family CutC-like 0.00023
Further Details:      
 
Domain Number 2 Region: 202-270
Classification Level Classification E-value
Superfamily CutC-like 0.00000000222
Family CutC-like 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCHOP00000008264   Gene: ENSCHOG00000009342   Transcript: ENSCHOT00000009361
Sequence length 274
Comment pep:known_by_projection genescaffold:choHof1:GeneScaffold_179:24593:42234:1 gene:ENSCHOG00000009342 transcript:ENSCHOT00000009361 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRQGVSTERKRARIPSGKAGAANGFLMEVCVDSVESAVNAERGGLGRIELWSGVMEEEP
TPRGGGVLQVVKQSVQIPVFVMIRPRGGDFLYSDREIEVMKADIRLAKLYGADGLVFGAL
TEDGHIDKELCMSLVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXGGITERNLQRILEGSGATEFHCSARSARDSGMKFRNSS
VAMGASLSNSEYSLTVTDVTKVRTLNAIAKNILV
Download sequence
Identical sequences ENSCHOP00000008264 ENSCHOP00000008264

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]