SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCHOP00000001625 from Choloepus hoffmanni 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCHOP00000001625
Domain Number 1 Region: 116-426
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.18e-50
Family L-arabinose binding protein-like 0.00095
Further Details:      
 
Domain Number 2 Region: 510-743
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.04e-37
Family Protein kinases, catalytic subunit 0.0005
Further Details:      
 
Domain Number 3 Region: 808-923
Classification Level Classification E-value
Superfamily Nucleotide cyclase 5.49e-33
Family Adenylyl and guanylyl cyclase catalytic domain 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCHOP00000001625   Gene: ENSCHOG00000001843   Transcript: ENSCHOT00000001851
Sequence length 1071
Comment pep:known_by_projection genescaffold:choHof1:GeneScaffold_626:422:61039:-1 gene:ENSCHOG00000001843 transcript:ENSCHOT00000001851 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTLVLSLALWWSLLLQPALIFGFSHVRKNCGNDFYVISVLNMSNSAFPEALEDLKAVVN
EGLDIVRMRLHEAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKDGMGCVLM
GPSCTYSTFQMYLDTDLNYPMISAGSFGLSCDYKETLTRLMSPSRKLTYFLVNFWKDKNL
PFKTFSWNTAYVFKNNTESEDCFWYLNALEAGVSYFSQELIFKDILRGSDQFQAILMDPN
RKSNVIVMCGKPDIVDTLKGDRPVAEDIVIILVDLFNDYYFEENVTAPDYMKNVLVLTLP
PRNSKLNSSRGLSLVKNDFALAYLNGVLLFGHMLKTFLEKEENVNSPEFAHAFKNLTFEG
YLGPVTLDDFGDVDNTMVLLYTSVNTKKYTVLLNYTTHENKTYPEDKSPTFTWRNHKLPN
DIPSQGPQALMIAVFTLTGAVILLLLIALLVLRKFRKDNELRQKKWSHIPPEKILPLESN
ETNHVSLKXXXXXXXXXXXXXXXXXXXXXRVILKDLKHNDGNFSEKQKIDLNKLLQIDYY
NLTKFYGTVKLENMIFGVIEYCERGSLRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMS
YLHSSKTEVHGRLKSTNCVVDSRMVVKITDFGCNAILPPRKDLWTAPEHLRQDSISQKGD
VYSYGIIAQEIILRRETFYTLSCRDQNEKIFRVQNSSDLKPFRPDLFLETAEEKELEVYL
LVKSCWEEDPEKRPDFKKIENTLAKIFGLFHDQKNESYMDTLIRRLQLYSRNLEHLVEER
TQLYKAERDRADRLNFMLLPRLVVKSLKEKGIVEPELYEEVTIYFSDIVGFTTICKYSTP
MEVVDMLNDIYKSFDHILDHHDVYKVETIGDAYMVASGLPKRNGNRHAVDIAKMALDILS
FMGTFELEHLPGLPIWIRIGVHSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRI
HASGSTIAILKRTECQFLYEVRGETYLKXXXXXXXXXXXXXXXXXXXXXXXXXXENQQRL
QAEFSDMIASSLQKRQAAGIRSRKPTRIASYKKGTLEYLQLNTTDKENTYF
Download sequence
Identical sequences ENSCHOP00000001625 ENSCHOP00000001625

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]