SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCHOP00000001849 from Choloepus hoffmanni 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCHOP00000001849
Domain Number 1 Region: 128-261
Classification Level Classification E-value
Superfamily L domain-like 9.18e-16
Family mRNA export factor tap 0.044
Further Details:      
 
Domain Number 2 Region: 302-384
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000000199
Family Ubiquitin-related 0.011
Further Details:      
 
Domain Number 3 Region: 52-112
Classification Level Classification E-value
Superfamily L domain-like 0.000000051
Family Ngr ectodomain-like 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCHOP00000001849   Gene: ENSCHOG00000002091   Transcript: ENSCHOT00000002101
Sequence length 387
Comment pep:known_by_projection genescaffold:choHof1:GeneScaffold_4909:8339:31511:1 gene:ENSCHOG00000002091 transcript:ENSCHOT00000002101 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDQPSGRSFMQVLCEKYSPENFPYRRGPGMGVHVPATPQGSPMKDRLNLPSVLVLNSCGI
TCAGDEKEIAAFCAHVSELDLSDNKLEDWHEVSKIVSNVPQLEFLNLSSNPLNLSVLERT
CAGSFSGVRKLVLNNSKASWETVHTILQELPPQNWTEIRKLGVMFPSLDTLVLANNHLNA
IEEPDDSLARLFPNLRSISLHKSGLHSWEDIDKLNSFPKLEEVRLLGIPLLQPYTTEERR
KLVVARLPSVSKLNGSVVTDSEREDSERFFIRYYVDVPQEEVPFRYHELITKYGKLEPLA
EVDLRPQSSAKVEVHFNDQVEEMSIRLDQTVAELKKQLKTLVQPTHMLLYYFDHQAPFPE
EMKYSSRALHSFGIRDGDKIYVESKTK
Download sequence
Identical sequences ENSCHOP00000001849 ENSCHOP00000001849

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]