SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCHOP00000002214 from Choloepus hoffmanni 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCHOP00000002214
Domain Number 1 Region: 298-510
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase FAD-binding domain 5.63e-75
Family Cryptochrome/photolyase FAD-binding domain 0.0000143
Further Details:      
 
Domain Number 2 Region: 26-207
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase, N-terminal domain 7.33e-50
Family Cryptochrome/photolyase, N-terminal domain 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCHOP00000002214   Gene: ENSCHOG00000002496   Transcript: ENSCHOT00000002510
Sequence length 595
Comment pep:known_by_projection genescaffold:choHof1:GeneScaffold_2717:1868:19541:1 gene:ENSCHOG00000002496 transcript:ENSCHOT00000002510 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAATAVMAGSAGSASPAPASGTEGASSVHWFRKGLLHDNPALLAAVRGARCVRCVYILDP
WFAASSSVGINRWRFLLQSLEDLDTSLRKLNSRLFVVRGQPADVFPRLFKEWGVTRLTFE
YDSEPFGKERDAAIMKMAKEAGVEVVTENSHTLYDLDRIIELNGQKPPLTYKRFQAIISR
MELPKKPVGSVTSQQMESCRAEIQENHDETYGVPXXXXXXFPTEGLGPAVWQGGEAEALA
RLDKHLERKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVKRN
STPPLSLFGQLLWREFFYTAATNNPRFDRMEGNPICIQIPWDRNPEALAKWAEGKTGFPW
IDAIMTQLRQEGWIHHLARHAVACFLTRGDLWVSWESGVRVFDELLLDADFSVNSGSWMW
LSCSAFFQQFFHCYCPVGFGRRTDPSGDYIRRYLPKLKGFPSRYIYEPWNAPESIQKAAK
CIIGVDYPRPIVNHAETSRLNIERMKQIYQQLSRYRGLCLLASVPSCVEDLSNPVAEPSS
SQAGSMSSAGPRPVPSGPASPKRKLEAAEEPPGEELSKRARVTELPTPELPSKDV
Download sequence
Identical sequences ENSCHOP00000002214 ENSCHOP00000002214

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]