SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCHOP00000002467 from Choloepus hoffmanni 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCHOP00000002467
Domain Number 1 Region: 12-110
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 6.04e-18
Family L-arabinose binding protein-like 0.000092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCHOP00000002467   Gene: ENSCHOG00000002775   Transcript: ENSCHOT00000002800
Sequence length 558
Comment pep:novel genescaffold:choHof1:GeneScaffold_6751:17414:33951:-1 gene:ENSCHOG00000002775 transcript:ENSCHOT00000002800 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TGEERIGRDSTYEQEGKVQFVIDAVYAIAHALHSMHRALCPGHTGLCPAMEPTDGRLLLQ
YIRRPLQSAGTPVMFNEKGDAPGRYDIFQYQATNGSAGSGGYQAVGQWAETLRLEVSAPT
GRAGGGCGSPRRQRWQAWSPSQVEDLQWSGDPREVPQSQCSLPCGPGERKKMVKGVPCCW
HCEACXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXISIKDLSASVSLGMLYXXXXXXXXXLGSSEPRGIQTKGLGD
LSHMRGMVMCWLHSLVNNRKVEGGCVESMLLKMEHCKLINSVPEGSQMVVLQLVIENFCV
ANQTRKASLQFFQTTAYGTITGMDELFKLAGLSPSTTAGTDLMLSLKTKRMTKKLGLEMC
LSGIQGFLTSVNSLVMDK
Download sequence
Identical sequences ENSCHOP00000002467 ENSCHOP00000002467

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]