SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCHOP00000002696 from Choloepus hoffmanni 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCHOP00000002696
Domain Number 1 Region: 970-1178
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.35e-68
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00003
Further Details:      
 
Domain Number 2 Region: 213-356
Classification Level Classification E-value
Superfamily PH domain-like 6.76e-32
Family Third domain of FERM 0.0063
Further Details:      
 
Domain Number 3 Region: 105-212
Classification Level Classification E-value
Superfamily Second domain of FERM 6.28e-29
Family Second domain of FERM 0.0004
Further Details:      
 
Domain Number 4 Region: 18-104
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.37e-20
Family First domain of FERM 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCHOP00000002696   Gene: ENSCHOG00000003033   Transcript: ENSCHOT00000003054
Sequence length 1182
Comment pep:known_by_projection genescaffold:choHof1:GeneScaffold_4771:4172:92188:-1 gene:ENSCHOG00000003033 transcript:ENSCHOT00000003054 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPFGLKLRRTRRYNVLSKNCFVTRIRLLDSNVIECTLSVESTGQECLEAVAQRLELRETH
YFGLWFLSKSQQARWVELEKPLKKHLDKFANEPLLFFGVMFYVPNVSWLQQEATRYQYYL
QVKKDVLEGRLRCTLEQVIRLAGLAVQADFGDFDQYESQDFLQKFALFPVDLALEEAVLE
ELTQKVAQEHKAHSGILPAEAELMYINEVERLDGFGQESFPVKDNHGNGVHLGIFFMGIF
VKNRIGRQALIYRWNDIGNITHNKSTILVELINKEETALFHTDDIENAKYISRLFATRHK
FYKQNKICTEQSNSPPPIRRQPTWSRSSLPRQQPYILPPMHVQCGEHYSETHTSQDSIFH
GNEEALYCNSHNSLDLNYLNGTVTNGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXQNYLFRPPPPYPRPRPATSTPDLASHRHKYVSGSSPDLVTR
KVQLSVKTFQEDSSPVVHQSLQEVSEPLTATKHHGTVNKRHSLEVMNSMVRGMEAMTLKS
LNLPMARRNTLREQVPPEEGPGSHEVHQLPHYHHKKTFSDATMLIHSSESEEEEEAPESV
PQIPMLREKMEYSAQLQAALARIPNKPPPEYPGPRKSVSNGALRQDQVSLPPAVARARVL
RHGPAKAISVSRADQLAVNGSSLGPSISEPDLTSVKERVKKEPVKERPVSEMFSLEDSII
EREMMIRNLEKQKMAGLEAQKRPLMLAALNGLSVARVPGREEHRTDATRVPMDERFRSLE
ELGEGVFTYEQIPRKANGIFSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXVVVGGAEWHYIATQGPLPHTCHDFWQMVWEQSANVIAMVTAEEEGGRTKSHRYWPK
LGSKHSSATYGKFKVTTKFRTDSGCYATTGLKVKHLLSGQERTVWHLQYTDWPDHGCPED
VQGFLSYLEEIQSVRRHTNSMLEGTKNQHPPIIVHCSAGVGRTGVVILSELMIYCLEHNE
KVEVPMMLRLLREQRMFMIQTIAQYKFVYQVLIQFLQNSRLI
Download sequence
Identical sequences ENSCHOP00000002696 ENSCHOP00000002696

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]