SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCHOP00000003709 from Choloepus hoffmanni 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCHOP00000003709
Domain Number 1 Region: 37-92
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000000122
Family Ubiquitin-related 0.0000712
Further Details:      
 
Domain Number 2 Region: 336-376
Classification Level Classification E-value
Superfamily UBA-like 0.000000000223
Family UBA domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCHOP00000003709   Gene: ENSCHOG00000004195   Transcript: ENSCHOT00000004210
Sequence length 380
Comment pep:known_by_projection genescaffold:choHof1:GeneScaffold_3869:3275:13847:-1 gene:ENSCHOG00000004195 transcript:ENSCHOT00000004210 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLSDWHLAVKLADQPLAPKSILRLPETELGEYSLGGYSISFLKQLIAGKLQESVPDPEL
IDLIYCGRKLKDDQTLDFYGIQPGSTVHVLRKSWPEPDQKPEPVDRVAALREFRVLHTAL
HSSSSYREAVFKMLSNKESLDQIIVATPGLSSDPIALGVLQDKDLFSVFADPNMLDTLVP
AHPALVNAIVLVLHSVAGSTPLPGADSSSRSMPSSSYRDMPGGFLFEGLSDDEDDFHPSA
RSTPSSSTPSSRPASLGYSGAAGPRPITQSELATALALASTPESSSHTPTPGTQXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSQWQPQLQQLRDMGIQDDELSLRAL
QATGGDIQAALELIFAGGAP
Download sequence
Identical sequences ENSCHOP00000003709 ENSCHOP00000003709

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]