SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCHOP00000005428 from Choloepus hoffmanni 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCHOP00000005428
Domain Number 1 Region: 187-299
Classification Level Classification E-value
Superfamily PH domain-like 8.3e-29
Family Third domain of FERM 0.001
Further Details:      
 
Domain Number 2 Region: 2-63
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.75e-20
Family First domain of FERM 0.001
Further Details:      
 
Domain Number 3 Region: 59-109
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000000000000536
Family Second domain of FERM 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCHOP00000005428   Gene: ENSCHOG00000006132   Transcript: ENSCHOT00000006155
Sequence length 831
Comment pep:known_by_projection genescaffold:choHof1:GeneScaffold_1144:6417:102177:-1 gene:ENSCHOG00000006132 transcript:ENSCHOT00000006155 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KHAKGQDLFDQIVYHLDLVETDYFGLQFLDSAQVAHWLDHSKPIKKQMKIGPAYALHFRV
KYYSSEPNNLREEFTRYLFVLQLRHDILSGKLKCPYETAVELAALCLQXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGR
DGCEYSGLTPTGILIFEGANKIGLFFWPKITKMDFKKSKLTLMVVEDDDQGREQEHTFVF
RLDSARTCKHLWKCAVEHHAFFRLRAPGNSKSNRSDFIRLGSRFRFSGRTEYQATHDARL
RRTSTFERKPSKRYPSRRHSTFKASNPVIAAQLCSKTNPEVHNYQXXXXXXXXXXXXXXX
XXXXXXXYPLPSPVLSSSDRLPFGIEENGGTPFTAKASGRHHQHQHQHHHQHQHQHHPNY
GLSLALENKEGPARSPNSSCKSLAKLSPGAPALFSEAAAQLKKLELETAKAAAPWPALHI
NINKAEEKKVSEKTLQTPVLPSPVADHVKCNILKAQLEDASRGNPQVGKEESTFVNINKK
SSLQDANVRSPIPIRVETTQPAMEKPEIKPPRVRKLTRQYSFDEDDLPPDLAKAVEAPAT
TAAHTTTTTAAASQASATLVSPKIQKVSLPQQLDGSGQPSPGAKXXXXXXXXXXXXXXXX
XXXXXXXXXXAEPASAPHCAHSRCPPLSLPMKEETPGVCMHPPIKTRLIKTFPADPVNPF
LDPFTAGPPFTADFRDSKLQYCPGLSSPLIPAATLRPSAETGSTVQAVYPEASFSGRQRR
DAPARTPAGTGERENDEKTIDDRTVKFSRCRLEDGMVPSVHFHYLGVVCSH
Download sequence
Identical sequences ENSCHOP00000005428 ENSCHOP00000005428

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]