SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCHOP00000006100 from Choloepus hoffmanni 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCHOP00000006100
Domain Number 1 Region: 650-725
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 6.28e-28
Family AN1-like Zinc finger 0.0000112
Further Details:      
 
Domain Number 2 Region: 2-104
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.4e-24
Family Ubiquitin-related 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCHOP00000006100   Gene: ENSCHOG00000006881   Transcript: ENSCHOT00000006903
Sequence length 730
Comment pep:known_by_projection genescaffold:choHof1:GeneScaffold_6432:1503:24259:-1 gene:ENSCHOG00000006881 transcript:ENSCHOT00000006903 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDNKKEPPFFNEDNVGPFYCQFPFCDTMELFIETLTGTCFELRVSPFESVISVKAKIQRL
EGIPVCQQHLIWNNVELEDDYCLNDHNISEGCTLKLVLTMRGGPINTRRVPMEDPLREMA
EYMDSSRDEVWEKTSCNKQVTFLVYRGDQLNFFRVVDRGDGTLTPLSESLRINFHLHFSL
RKGEHSMFGGSVYNLYMDEEEEIEPSPSGQQIIENSITMNKMKLLKAKMENMNLSKKPKK
AIRVKPHPPVAHRPSSGSTAAARHRLLRVLPHIGQSCLPSPGNTYLPETSTNALASLSTL
TPADRPLSSITSDFLKDDDNWESNTLSHSNSSIKRPPQIPHLEFGYDKELTDSVLHLGPS
LPRQTEHFSGNLPSNNEDETALFPTTEQCVTEESLLPEVSSFASLTEGSTDEQSSGLEGM
RKVIPESFLTNSGKGLKATEHHLQHVARLLSDESVETTVLNHRELSPHKNRLLSPLRCSA
PLSLQNSLVKPQRQSKCSESGALQSSSQNVLRSLDVRNVTDPSLSRTTRFRGVKVDSPGK
RADIISKVEAQDITEMANKASKEPVGCVNNIGFFASLARSASRDSLQSTCGAGRLRTSGI
GLSTNLQHFQEESLRKTSPQLEPPEIFLSARGIGMNGNNAAAGKRVGECTHHLPPVKVPN
QTKKKTAKHCFLCGKKTGLATSYECRCGNNFCASHRYAETHGCTYDYKSAGRRYLQEANP
VVNAPKLPKI
Download sequence
Identical sequences ENSCHOP00000006100 ENSCHOP00000006100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]