SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCHOP00000006803 from Choloepus hoffmanni 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCHOP00000006803
Domain Number 1 Region: 18-219
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.49e-45
Family DBL homology domain (DH-domain) 0.00024
Further Details:      
 
Domain Number 2 Region: 263-447
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 8.11e-27
Family BAR domain 0.01
Further Details:      
 
Domain Number 3 Region: 495-552
Classification Level Classification E-value
Superfamily SH3-domain 0.0000759
Family SH3-domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCHOP00000006803   Gene: ENSCHOG00000007685   Transcript: ENSCHOT00000007704
Sequence length 553
Comment pep:known_by_projection genescaffold:choHof1:GeneScaffold_6967:14391:44449:1 gene:ENSCHOG00000007685 transcript:ENSCHOT00000007704 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGSEADEPSLRTGSPDGECQVSQDRRLLHQRLAIRELVDTEGSYVHMLQLCASDIRSRL
QQLPQEDLNVLFSNIDDIIKVNSRFLHELQEADSREEEQVNLIGNLFLEYQEELERVYKV
YCVSYNQALLLVETYRKEPELQREIQGIIEAVVPQAGASGLSFLLVIPLQRITKYPLLLQ
KILENTLPDASAYPILQRATSALQEVNANINEYKRRKEVXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXTEDKEFDDLEERFHWVALCATELKNNVAAYLDHMEXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKQRLEGLVWQPLCSLTKALAGPQNL
IKKRLDKLLDFERVGEKLLEVGSVTYRDEEARHTYQALNSLLLAELPHFNQLATQWLGQI
LRTFVALQRDFAKQVLQRAEGSLAQLPHHLLSEPAFRKLMEDMLGQTGDQLRSFQENFEK
MLPPSTIQPLLPGAERQVQALLSRYGPGKLYQVTSSISGAATLDLTLPRGQIVALLQNKD
TKGNSGRWLVDTG
Download sequence
Identical sequences ENSCHOP00000006803 ENSCHOP00000006803

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]