SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCHOP00000006823 from Choloepus hoffmanni 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCHOP00000006823
Domain Number 1 Region: 20-262,300-386
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 2.78e-25
Family L-arabinose binding protein-like 0.01
Further Details:      
 
Domain Number 2 Region: 634-753
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.74e-21
Family Phosphate binding protein-like 0.0000323
Further Details:      
 
Domain Number 3 Region: 425-491
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 0.00000000000282
Family Phosphate binding protein-like 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCHOP00000006823   Gene: ENSCHOG00000007699   Transcript: ENSCHOT00000007725
Sequence length 836
Comment pep:known_by_projection genescaffold:choHof1:GeneScaffold_4614:8917:128002:1 gene:ENSCHOG00000007699 transcript:ENSCHOT00000007725 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRVSAPLVLLPAWLMMVACSPHSLRIAAILDDPMECSRGERLSITLAKNRINRAPERLG
KAKVEVDIFELLRDSEYETAETLCQILPKGVVAVLGPSASPASSSIISNICGEKEXXXXX
XXXXXXXXXXXXXXXXXXXHPSTDISVAVAGIVNFFNCTTACLICAKAECLLNLEKLLRQ
FLISKDTLSVRMLDDTRDPTPLLKEIRDDKTATIIIHANASMSHTILLKAAELGMVSAYY
TYIFTNLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XLSSALLFDAVYAVVTAVQELNRSQEIGVKPLSCGSAQIWQHGTSLMNYLRMVELEGLTG
HIEFNSKGQRSNYALKILQFTRNGFRQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXENPYLMLKGNHQEMEGNDRYEGFCVDMLKELAEILRFNYKIRLVGDGVYGVPEANGT
WTGMVGELIARXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHMGRKPGYFSFLD
PFSPGVWLFMLLAYLAVSCVLFLVARLTPYEWYSPHPCAQGRCNLLVNQYSLGNSLWFPV
GGFMQQGSTIAPRALSTRCVSGVWWAFTLIIISSYTANLAAFLTVQRMDVPIESVDDLAD
QTAIEYGTIHGGSSMTFFQNSRYQTYQRMWNYMYSKQPSVFVKSTEEGIARVLNSNYAFL
LESTMNEYYRQRNCNLTQIGGLLDTKGYGIGMPVXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXLGMENIGGIFVVLICGLIVAIFMAMLEFLWTLHSEATE
Download sequence
Identical sequences ENSCHOP00000006823 ENSCHOP00000006823

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]