SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCHOP00000008900 from Choloepus hoffmanni 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCHOP00000008900
Domain Number 1 Region: 32-366
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 6.06e-61
Family L-arabinose binding protein-like 0.0011
Further Details:      
 
Domain Number 2 Region: 433-546,665-770
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 4.56e-41
Family Phosphate binding protein-like 0.0000000167
Further Details:      
 
Weak hits

Sequence:  ENSCHOP00000008900
Domain Number - Region: 564-660
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00385
Family Voltage-gated potassium channels 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCHOP00000008900   Gene: ENSCHOG00000010043   Transcript: ENSCHOT00000010075
Sequence length 935
Comment pep:known_by_projection genescaffold:choHof1:GeneScaffold_6316:13171:190537:-1 gene:ENSCHOG00000010043 transcript:ENSCHOT00000010075 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERGTLLAQPGLWTGDTSWALLYFLCCILPQTAPQVLRIGGIFETVESEPVNIEELAFKF
AVTNINRNRTLMPNTTLTYDIQRINLFDSFEASRRACDQLALGVAALFGPSHSSSVSAVQ
SICNALEVPHIQTRWKHPSVDNKDLFYINLYPDYAAISRAVLDLVLYYNWKTVTVVYEDS
TGLIRLQELIKAPSRYNIKIKIRQLPSGNKDAKPLLKEMKKGKEFYVIFDCSHETAAEIL
KQILFMGMMTEYYHYFFTTLDLFALDLELYRYSGVNMTGFRLLNIDNPHVSSIIEKWSME
RLQAPPRPETGLLDGMMTTEAALMYDAVYMVAMASHRASQLTVSSLQCHRHKPWRLGPRF
MNLIKEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAAIGIWNSNSGLNMTDGN
KDRSNNITDSLANRTLIVTTILEEPYVMYRKSDKPLYGNDRFEGYCLDLLKELSNILGFI
YDVKLVPDGKYGAQNDKGEWNGMVRELIDHXXXXXXXXXXXXXXRKVIDFSKPFMTLGIS
ILYRKPNGTNPGVFSFLNPLSPDIWMYVLLACLGVSCVLFVIARFTPYEWYNPHPCNPDS
DVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFL
TVERMESPIDSADDLAKQTKIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRQQTALVK
NSDEGIQRVLMTDYALLMESTSIEYVTQRNCNLTQIGGLIDSKGYGVGTPIXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCLSFNAIMEELGISLK
NQKKLKKKSRTKGKSSFTSILTCHQRRTQRKETVA
Download sequence
Identical sequences ENSCHOP00000008900 ENSCHOP00000008900

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]