SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCHOP00000009284 from Choloepus hoffmanni 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCHOP00000009284
Domain Number 1 Region: 169-315
Classification Level Classification E-value
Superfamily PH domain-like 1.94e-36
Family Third domain of FERM 0.00071
Further Details:      
 
Domain Number 2 Region: 110-171
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000000000000116
Family Second domain of FERM 0.00065
Further Details:      
 
Domain Number 3 Region: 5-65
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000331
Family First domain of FERM 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCHOP00000009284   Gene: ENSCHOG00000010485   Transcript: ENSCHOT00000010514
Sequence length 651
Comment pep:known_by_projection genescaffold:choHof1:GeneScaffold_3099:1986:74017:-1 gene:ENSCHOG00000010485 transcript:ENSCHOT00000010514 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KSTKGVLDTVFRQINLDEKDNIELXXXXXXXXXYWLDPAKTLAEHKELINTGPPYTLYFG
IKFYAEDPCKLKEEITXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELGDYNPFKH
TAGYVSEYRFVPDQKEELEEAIERIHKTLMGQASSEAELNYLRTAKSLEMYGVDLHPVYG
ENKSEYFLGLTPVGIVVYKNKKQVGKYFWPRITKVHFKETQFELRVLGKDCNETSFFFEA
RSKTACKHLWKCSVEHHTFFRMPENESNSLSRKLSKFGSMGYKHRYSGRTALQMSRDLSI
QLPRPDQNVARSRSKTYPKRIAQTPPAGSNSINRVTANLENGGNEGTTKIIAPSPVKSFK
KTKNENSPDTQRSKSHAPWEENSPQSVLFNSPNDRSKSXXXXXXXXXXXXXXXXXXXXXX
XXXXKAHNSGEDSDLKQRRRSRSRCNTSSGSESENSNREHRKKRNRIRQENDMVDSAPQW
EAVLRRHKEKNQADPNNRRSRHRSRSRSPDIQAKEELWKHIXXXXXXXXXXXXXXXXXXX
XXXXXTQGDPIRIRHSHSPRSYRQYRRSQCSDGERSVLSEVNSKTDLVPPLPVTRSSDAQ
GSGGSTVHQRRNGSKDSLIEEKSQTSTSNLAGKHSAKTIKTAQASRLKIET
Download sequence
Identical sequences ENSCHOP00000009284 ENSCHOP00000009284

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]