SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCHOP00000009752 from Choloepus hoffmanni 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCHOP00000009752
Domain Number 1 Region: 2227-2527
Classification Level Classification E-value
Superfamily BEACH domain 6.93e-127
Family BEACH domain 0.0000000000188
Further Details:      
 
Domain Number 2 Region: 2115-2222
Classification Level Classification E-value
Superfamily PH domain-like 2.15e-29
Family PreBEACH PH-like domain 0.00000237
Further Details:      
 
Domain Number 3 Region: 182-368
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.77e-28
Family Clostridium neurotoxins, the second last domain 0.013
Further Details:      
 
Domain Number 4 Region: 2639-2728,2773-2847
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00000000000458
Family WD40-repeat 0.005
Further Details:      
 
Weak hits

Sequence:  ENSCHOP00000009752
Domain Number - Region: 485-568,796-935
Classification Level Classification E-value
Superfamily ARM repeat 0.00345
Family Plakophilin 1 helical region 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCHOP00000009752   Gene: ENSCHOG00000010950   Transcript: ENSCHOT00000011044
Sequence length 2849
Comment pep:known_by_projection genescaffold:choHof1:GeneScaffold_6448:6801:360315:1 gene:ENSCHOG00000010950 transcript:ENSCHOT00000011044 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASDKPGPGPGLEPPPTALVAVGGGGGSGAVVLPAGMINPSVPIRNIRMKFAVLIGLIQV
GEVSNRDIVETVLNLLVGGEFDLEMNFIIDAESVTCMTELLEHCDVTCQAEIWSMFTAIL
RKSVRNLTSTEVGLIEQVLLKMDMITDLLVDVLGVLASYSITVKELKLLFSMPRGESGIW
PRYAVKLLSVLNQMPQRHGPDTFFNFPRCSAAANALPPIAKWPYQNGFTLNTWFRMDPLN
IITVDKDQPYLYCFRTSKGVGYSAHFVGNCLIVTSLKSKGKGFQHCVKYDFQPRKWYMIS
IVHIYNRWRNSEIRCYVNGQLVSYGDMAWHVNTNDSYDKCFLRSSETAAANGVSCGQLGA
VYVFREVLNPAQILGPGYKSTFKFKSESDIHLAEHHKQVLYDGKLASSIAFTYNAKAAAR
LCLESSPKENASIFVHSPHAVMLQDVKAIVTHSIHSAIHSTGGIQVLFPLFGQLDNRQLT
DGRVETTVCATLLAFLVELLKSSVAMQEQMLGGKGFLVIGYLLEKSSRVHITRAVLEQFL
SFAKYLDGLSHGAPLLKQLCDHVLFNPAIWIHTPAKVQLSLYTYLSAEFIGTATIYTTIR
RVGTVLQLMHTLKYYYWVINPADSSGIAPRGLXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXRKVEIMHTHSLFTLLGERLMLHTNTVTVTTYNTLYE
ILTEQVCTQVVHKPHPEPDSTVKIQNPMILKVVATLLKNSTPSAELMEVRRLFLSDMIKL
FSNSRENRRCLLQCSVWQDWMFSLGYINPKNSEEQKVTEMVYNIFRILLYHAIKYEWGGW
RVWVDTLSIAHSKVTYEAHKEYLAKMYEEYQRQEEENIKKGKKGSVSTISGLSSQATGAK
GGMEIREMEDLSQSQSPESETDYPVSTDTRDLLMSAKVSEDILGNPDRPGSGVHVEVHDL
LVDIKAEKVEATEVKLDDLDLSPETLVGGENGALVEVESLLDNVYSAAVEKLQSNVHGTA
VLRKNEDKDNGPLITLADEKDELPGRAASFLFDKLPKQEEKLLPELSSSHIIPSIQDAQV
HLGVGDDLGLLAHVAASVDLTCTSSILEEKEFKIHTAADGMSSISERDLAPPSKGLEYAE
MTATTLETESSGSKMVPNIDAGSIISDTERSDDGKESGKEIRKIQTTATTQXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXHSTKSVMDFVNSNENIIFVHNTIHLISQMVDNIIIACGGILPLLSAATSPTVSRTE
LEAIEVTQGMSAETAVTFLGRLMAMVDALVFASSLNFSEIEAEKNMSSGGLMRQCLRLVC
CVAVRNCLECRQRQRARGSKCAHGGGGGRPLDAPQGGPAAAATSKPLESIPNLFPIKEDR
FFQDVDIIRLGAVVFRDVDDSKQAQFLALAVVYFISVLMVSKYRDILEPQRETARTGSQP
GRNVRQEINSPTSTVVAIPSVSHPSLNHGFLAKLIPEQSFPHSFYKETPAAFPDTIKEKE
TPAPGEDTQLESSVPHTDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXSVVVPVKKAPPGSLAVTTVGAPAAGSAPPAGSTANIFAATGATPKSM
INTTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLVCMKSSTSVVELVMLLCSQEWQNSIQKNA
GLAFIELINEGRLLCHAMKDHIVRVANEAEFILNRQRAEDVHKHAEFEXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXR
RRRRFVRNAFGSTHTEALLKAAIEYGTDEDVVKSKKAFRSQAIVNQNAETELMLEGDDDA
VSLLQEKEIDNLAGPVVLSTPAQLIAPAVVAKGTLSITTTEIYFEVDEDGPAFKKIDTKV
LAYTEGLHGKWMFSEIRAVFSRRYLLQNTALEVFMANRTSVMFNFPDQATVKKVVYSLPR
VGVGTSYGLPQARRISLATPRQLYKSSNMTQRWQRREISNFEYLMFLNTIAGRTYNDLNQ
YPVFPWVLTNYESEELDLTLPGNFRDLSKPIGALNPKRAVFYAERYETCDDDQSPPCHYS
THYSTAVSTLSWLVRIEPFTTFFLNANDGKFDHPDRTFSSVARSWRTSQRDTADVKELIP
EFYYLPEMFVNSNGYNFGVREDEVVVNDIDLPPWAKKPEDFVRINRMALESEFVSCQLHQ
WIDLIFGYKQRGPEAVRALNVFHYLTYEGSVSLDALTDPVLREAMEAQIQNFGQTPSQLL
IEPHPPRSSAMHLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXLRGAPGYSLEQAHHLPIEMDPLIANNSGVNKRQITDLVDQSI
QINAHCFVVTADNRYILICGFWDKSFRVYSTETGKLTQIVFGHWDVVTCLARSESYIGGD
CYIVSGSRDATLLLWYWSGRHHIIGDNPNSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXGPCLVHTITGDLLRALEGPENCLFPRLISVSSEGHCIIYYERGRFSNFSINGKLL
AQMEISDSTRAILLSSDGQTLMTARDSGV
Download sequence
Identical sequences ENSCHOP00000009752 ENSCHOP00000009752

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]