SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCHOP00000010447 from Choloepus hoffmanni 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCHOP00000010447
Domain Number 1 Region: 250-328
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000000596
Family Ubiquitin-related 0.0022
Further Details:      
 
Domain Number 2 Region: 165-244
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000303
Family Ubiquitin-related 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCHOP00000010447   Gene: ENSCHOG00000011828   Transcript: ENSCHOT00000011856
Sequence length 329
Comment pep:known_by_projection genescaffold:choHof1:GeneScaffold_6696:5:4876:1 gene:ENSCHOG00000011828 transcript:ENSCHOT00000011856 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DSEGTDTRPAGAPRPPVRRRRRLLLDPEEAPVVPVYSGKVKSSLHLIPDHLSLLKLCPQG
AEEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVQDTSPLPSPPPRTKSR
KHTRALQKLREVSRRLHDLRSCLSPLQHQGQDHWNQDDEVVLVEGSTVPESPRLFPLKIR
CRADLIRLPVEMSEPLQGVVDHLAARLGVSPSRIPLLFGEAELSPTATPKTLILGVADII
DCVVLASSPEATEMSQQLQLRVQGKEKHQMLEVSLARDSPLKTLMSRYEEAMGLSGHKLS
FFFDGAKLSGKELPADLGMESGDLIEVWS
Download sequence
Identical sequences ENSCHOP00000010447 ENSCHOP00000010447

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]