SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCHOP00000011462 from Choloepus hoffmanni 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCHOP00000011462
Domain Number 1 Region: 240-370
Classification Level Classification E-value
Superfamily PH domain-like 1.26e-22
Family Third domain of FERM 0.004
Further Details:      
 
Domain Number 2 Region: 123-187
Classification Level Classification E-value
Superfamily Second domain of FERM 5.5e-17
Family Second domain of FERM 0.0043
Further Details:      
 
Domain Number 3 Region: 17-63
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000393
Family First domain of FERM 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCHOP00000011462   Gene: ENSCHOG00000012932   Transcript: ENSCHOT00000012976
Sequence length 622
Comment pep:known_by_projection genescaffold:choHof1:GeneScaffold_3990:42068:83932:1 gene:ENSCHOG00000012932 transcript:ENSCHOT00000012976 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKLNFHNNRVMQDRRSVCIFLPNDESLNIIINVKILCHQLLVQVCDLLRLKDCHLFGLS
VIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXDRAARYYYYWHLRKQVLHSQCVLREEAYFLLAAFALQADLGNFKRNKHYGRYFEPE
AYFPSWXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYKDK
REIEASLTLGLTMRGIQIFQNLDEEKQLLYDFPWTNVGKLVFVGKKFEILPDGLPSARKL
IYYTGCPMRSRHLLQLLSNSHRLYMNLQPVLRHIRKLEENEEKKQYRESYISDNLDLDMD
QLEKRSRASGSSAGSMKHKRLSRHSTASHSSSHTSGIEADTKPRDAGPEDSYSGSAIHRK
LKTCSSMTSHGSSHTSGVESGGKDRLEEDLQDDEIEMLVDDPRDLEQMNEESLEVSPDMC
IYITEDMLMSRKMNGHSGLIVKEIGSSTSSSSETVVKLRGQSTDSLPQTICRKPKTSTDR
HSLSLDDVRLYQKDFLRLAGLCQDTAQSYTFGCGHELDEEGLYCNSCLAQQCINIQDAFP
VKRTSKYFSLDLTHDEVPEFVV
Download sequence
Identical sequences ENSCHOP00000011462 ENSCHOP00000011462

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]