SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|513841569|ref|YP_008121541.1| from Lactobacillus plantarum 16

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|513841569|ref|YP_008121541.1|
Domain Number 1 Region: 207-600
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 5.27e-86
Family beta-Lactamase/D-ala carboxypeptidase 0.000000425
Further Details:      
 
Domain Number 2 Region: 66-250
Classification Level Classification E-value
Superfamily Penicillin binding protein dimerisation domain 1.03e-35
Family Penicillin binding protein dimerisation domain 0.0000401
Further Details:      
 
Domain Number 3 Region: 598-656
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00000000000017
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0046
Further Details:      
 
Domain Number 4 Region: 659-712
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00000000000916
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|513841569|ref|YP_008121541.1|
Sequence length 713
Comment transpeptidase, penicillin binding protein 2B [Lactobacillus plantarum 16]
Sequence
MNKNKQRMTSKRSPKQNRRIFGQWLFFGAIAVFGVLIIRFSYIAIVRHVNGVNLVEATKK
LYTEDQTITAKRGTIYTANGDPIAEDTSTYTVYAIMAKNQQSASGKALYVKNNAKAARVL
SKYLPISYKKALATLQKGAGKFQIEFGTAGKNISLTTKEKIDAQNVAGLHFIESEARLYP
NGTFASHLVGLTTSKSQKDTDQTRLTGSMGIELAFNKQLSGTDGRKTITKSGYQGSTETG
KKVKDGDNIYTTIDSKLQTLLETKVSQVNAKVSPKSMTATLMNAKTGAILATTQRPTFNA
QTKTGLSKMWRNLLVEDTYEPGSTMKVFTMAAAIDSGKYNANVTVPTGEYKIGNNTVPDW
NTSGWGNITYAKGFALSSNTAMAHLEQAMGAKTWLKYIKRFGLRESTNSGLDNEQSGSIQ
FTYPIEQADTAFGQGIQVTAMQMLRGFTAIANHGKMLQPYFISKITNPNTNKTVYTGKKK
VVSQPISSKTASKVLDHMQDVVYKSYGTGSSYKISGYRIAAKTGTAQVSNGSTYEQGDNT
YLYSVVGMAPAKNPKYIMYITMKQPTLNGSSASDDMAEIFDTVMKRALEEQKASETKATT
IKMKDLTSKSTSAAKKAAKKQGLDVVVVGKGSRVVKQSISSGTVVSSGQRVILVTNGQMY
MPNLSGWSASEVADFATLTGVKLTTSGTGYVKTQSVTAGNPIEAKQAISVTLK
Download sequence
Identical sequences A0A0L7Y017 A0A199QEA0 A0A2J6U5R8 A0A2K3C195 D7VDK2 M4KIU5 R9X6R9
gi|448821711|ref|YP_007414873.1| gi|308181000|ref|YP_003925128.1| 644042.JDM1_1841 WP_003640860.1.100103 WP_003640860.1.100207 WP_003640860.1.100379 WP_003640860.1.100429 WP_003640860.1.101934 WP_003640860.1.102085 WP_003640860.1.1220 WP_003640860.1.12236 WP_003640860.1.12283 WP_003640860.1.12549 WP_003640860.1.13966 WP_003640860.1.14222 WP_003640860.1.15471 WP_003640860.1.15989 WP_003640860.1.16071 WP_003640860.1.16633 WP_003640860.1.17377 WP_003640860.1.17493 WP_003640860.1.17979 WP_003640860.1.182 WP_003640860.1.19463 WP_003640860.1.19859 WP_003640860.1.2169 WP_003640860.1.21914 WP_003640860.1.22404 WP_003640860.1.22467 WP_003640860.1.25460 WP_003640860.1.25482 WP_003640860.1.26444 WP_003640860.1.27617 WP_003640860.1.28208 WP_003640860.1.28597 WP_003640860.1.28802 WP_003640860.1.29036 WP_003640860.1.29793 WP_003640860.1.30329 WP_003640860.1.31165 WP_003640860.1.3126 WP_003640860.1.33461 WP_003640860.1.33465 WP_003640860.1.34542 WP_003640860.1.34594 WP_003640860.1.34840 WP_003640860.1.35369 WP_003640860.1.36601 WP_003640860.1.37110 WP_003640860.1.37210 WP_003640860.1.37234 WP_003640860.1.37302 WP_003640860.1.37367 WP_003640860.1.37888 WP_003640860.1.37993 WP_003640860.1.39741 WP_003640860.1.4007 WP_003640860.1.40915 WP_003640860.1.40917 WP_003640860.1.42053 WP_003640860.1.42956 WP_003640860.1.4363 WP_003640860.1.43944 WP_003640860.1.44129 WP_003640860.1.44182 WP_003640860.1.45255 WP_003640860.1.47368 WP_003640860.1.48352 WP_003640860.1.48891 WP_003640860.1.49466 WP_003640860.1.49875 WP_003640860.1.50648 WP_003640860.1.51711 WP_003640860.1.52115 WP_003640860.1.52876 WP_003640860.1.53222 WP_003640860.1.53564 WP_003640860.1.54321 WP_003640860.1.54513 WP_003640860.1.56224 WP_003640860.1.56240 WP_003640860.1.56426 WP_003640860.1.56520 WP_003640860.1.58100 WP_003640860.1.59418 WP_003640860.1.59824 WP_003640860.1.60366 WP_003640860.1.60571 WP_003640860.1.62691 WP_003640860.1.6273 WP_003640860.1.64570 WP_003640860.1.65354 WP_003640860.1.65980 WP_003640860.1.66154 WP_003640860.1.6617 WP_003640860.1.6836 WP_003640860.1.68648 WP_003640860.1.68947 WP_003640860.1.69461 WP_003640860.1.69847 WP_003640860.1.69852 WP_003640860.1.71240 WP_003640860.1.71366 WP_003640860.1.71807 WP_003640860.1.731 WP_003640860.1.73311 WP_003640860.1.74718 WP_003640860.1.74868 WP_003640860.1.76397 WP_003640860.1.76549 WP_003640860.1.76699 WP_003640860.1.76771 WP_003640860.1.7682 WP_003640860.1.76822 WP_003640860.1.77712 WP_003640860.1.77972 WP_003640860.1.78144 WP_003640860.1.8010 WP_003640860.1.80520 WP_003640860.1.80904 WP_003640860.1.81615 WP_003640860.1.82268 WP_003640860.1.82388 WP_003640860.1.82735 WP_003640860.1.83366 WP_003640860.1.83647 WP_003640860.1.83777 WP_003640860.1.84028 WP_003640860.1.84419 WP_003640860.1.85836 WP_003640860.1.86479 WP_003640860.1.88099 WP_003640860.1.89637 WP_003640860.1.90117 WP_003640860.1.90208 WP_003640860.1.90300 WP_003640860.1.90426 WP_003640860.1.91137 WP_003640860.1.91351 WP_003640860.1.91683 WP_003640860.1.92145 WP_003640860.1.92629 WP_003640860.1.92717 WP_003640860.1.93143 WP_003640860.1.93409 WP_003640860.1.93688 WP_003640860.1.94382 WP_003640860.1.94656 WP_003640860.1.94667 WP_003640860.1.95302 WP_003640860.1.95345 WP_003640860.1.95554 WP_003640860.1.9589 WP_003640860.1.96838 WP_003640860.1.9731 WP_003640860.1.97443 WP_003640860.1.98090 WP_003640860.1.98190 WP_003640860.1.9834 WP_003640860.1.99945 gi|254557008|ref|YP_003063425.1| gi|501147101|ref|YP_007987439.1| gi|513841569|ref|YP_008121541.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]