SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|397653758|ref|YP_006494441.1| from Corynebacterium ulcerans 0102

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397653758|ref|YP_006494441.1|
Domain Number 1 Region: 2-319
Classification Level Classification E-value
Superfamily ATP synthase (F1-ATPase), gamma subunit 3.27e-75
Family ATP synthase (F1-ATPase), gamma subunit 0.0000412
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|397653758|ref|YP_006494441.1|
Sequence length 326
Comment ATP synthase subunit gamma [Corynebacterium ulcerans 0102]
Sequence
MANLRELRDRIRSVNSTKKITKAQELIATSRITKAQARVEASQPYATEIHKVMERLAAAS
SLDHPMLHEREDGKRAAVLVISSDRGMAGGYNYNVFKKAAELIKLLEDNGYEVVRYVTGN
KAVGYYKFRGEDVAGAWTGFSQDPSWEETHSVRRHLIDGFIAGSKGTAKYREGLNTGEGD
PIQGFDQVHVVYTEFESMLVQTARAHQLLPIEPVIETEEVQISDEGILQNAGEPTPDVEF
EPDADTLFEAMLPQYVSRSLFAMFLEAAAAESASRRNAMKSATDNATALVKDLSRVANQA
RQAQITQEITEIVGGASALGDSGESD
Download sequence
Identical sequences A0A0M5KQH9
WP_013911277.1.101040 WP_013911277.1.12475 WP_013911277.1.16856 WP_013911277.1.40100 WP_013911277.1.44734 WP_013911277.1.45382 WP_013911277.1.83743 WP_013911277.1.91675 WP_013911277.1.96929 gi|397653758|ref|YP_006494441.1| gi|337290520|ref|YP_004629541.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]