SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|397654100|ref|YP_006494783.1| from Corynebacterium ulcerans 0102

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397654100|ref|YP_006494783.1|
Domain Number 1 Region: 1-207
Classification Level Classification E-value
Superfamily Formyltransferase 3.27e-56
Family Formyltransferase 0.00000601
Further Details:      
 
Domain Number 2 Region: 211-312
Classification Level Classification E-value
Superfamily FMT C-terminal domain-like 2.67e-25
Family Post formyltransferase domain 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|397654100|ref|YP_006494783.1|
Sequence length 313
Comment methionyl-tRNA formyltransferase [Corynebacterium ulcerans 0102]
Sequence
MRLIFAGTPEPAVVALEKLLASDHEVIAVLTRPDAPKGRGRTLQPSPVSALAQQHGIEIL
TPTSIKPGTPDGEAFRARLEELSPDCVPVVAYGNLITQDLLDAVPHGWVNLHFSLLPAWR
GAAPVQSAIRNGDAVTGATTFRIDQGLDTGDILGTLKEPINPTDTSDDLLTRLAYAGADL
LVKTMDDLAAGKAEPRPQVGEPSYAHKILTDDAQIKWDATGADIDRLIRSVTPGPGAWTT
LDGQRFKLGPVTYIPAEECSAAAGEIVIEKNRVLVGTHHGCVKLDMIQPQGKKRMQASDW
ARGLHNKEGLRFE
Download sequence
Identical sequences WP_014525827.1.12475 WP_014525827.1.16856 WP_014525827.1.41020 WP_014525827.1.45382 WP_014525827.1.83743 WP_014525827.1.91675 gi|397654100|ref|YP_006494783.1| gi|384515756|ref|YP_005710848.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]