SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|445059068|ref|YP_007384472.1| from Staphylococcus warneri SG1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|445059068|ref|YP_007384472.1|
Domain Number 1 Region: 1-102
Classification Level Classification E-value
Superfamily Enzyme IIa from lactose specific PTS, IIa-lac 9.42e-33
Family Enzyme IIa from lactose specific PTS, IIa-lac 0.00000937
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|445059068|ref|YP_007384472.1|
Sequence length 103
Comment PTS system lactose-specific transporter subunit IIA [Staphylococcus warneri SG1]
Sequence
MNREEVQLIGFEIVAFAGDARSKFLEALTAAQNKDFDKAEALIEEGKSLIADAHKAQTSL
LAKEAQGEDIAYSVTMMHGQDHLMTTILLKDVMSHLIELYKRG
Download sequence
Identical sequences A0A1Q9MGC6 A0A1U0IMD6 A0A1V4CS04 A0A269XHZ8 A0A2K0DMP8 C4W8C3 L7WVG7
WP_002450492.1.15080 WP_002450492.1.25277 WP_002450492.1.25522 WP_002450492.1.32516 WP_002450492.1.32837 WP_002450492.1.44256 WP_002450492.1.46271 WP_002450492.1.4937 WP_002450492.1.66301 WP_002450492.1.66832 WP_002450492.1.70811 WP_002450492.1.77186 WP_002450492.1.78873 WP_002450492.1.85681 WP_002450492.1.89055 WP_002450492.1.94482 gi|445059068|ref|YP_007384472.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]