SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378825959|ref|YP_005188691.1| from Sinorhizobium fredii HH103

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378825959|ref|YP_005188691.1|
Domain Number 1 Region: 6-97
Classification Level Classification E-value
Superfamily YccV-like 1.14e-34
Family YccV-like 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|378825959|ref|YP_005188691.1|
Sequence length 109
Comment Hemimethylated DNA-binding protein [Sinorhizobium fredii HH103]
Sequence
MKQRNAKFEIGQIVRHRFFPFRGVIFDVDPEYANTEEWWNSIPQEIRPSKDQPFYHLFAE
NDESEYVAYVSEQNLVSDESDQPIRHTQVDALFEKADVGHYRPRADYRH
Download sequence
Identical sequences A0A0T6ZRJ7 A0A249PSU0 A0A2A6LT35 G9A6I6
WP_014328342.1.11773 WP_014328342.1.12909 WP_014328342.1.22659 WP_014328342.1.24350 WP_014328342.1.38284 WP_014328342.1.40010 WP_014328342.1.73819 WP_014328342.1.76914 WP_014328342.1.93056 gi|378825959|ref|YP_005188691.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]