SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|378762972|ref|YP_005191588.1| from Sinorhizobium fredii HH103

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378762972|ref|YP_005191588.1|
Domain Number 1 Region: 79-291
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.74e-29
Family Phosphate binding protein-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|378762972|ref|YP_005191588.1|
Sequence length 298
Comment K02030 polar amino acid transport system substrate-binding protein [Sinorhizobium fredii HH103]
Sequence
MPGRRRGDRDRRAVTRAPLAQDRLRARLFPRATPARRRHFIRTRTRASAVSGGAKDLTMK
QLFFLMTLLFPLAAQSADVKLVTESYPPFNFREGEVYKGASVEQVRLLMQDAGLQYTMEM
MPWARALFLAENHEMHCVFTTVHNKERHARFKWVEPLLKSRTVLIRKVGSPANPKTLDEA
KAFKVGTQRDDFTQTILEENGFPRIDLATDLELTLKKLLTGRIDLMPISEKYFDKLKREG
APIESTVVLAEDIYSIACNPSVPDELIGRMQKGLDKVIADGTQARLFEKYGLATDGQQ
Download sequence
Identical sequences gi|378762972|ref|YP_005191588.1| gi|378762972|ref|YP_005191588.1|NC_016815

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]