SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|407704304|ref|YP_006827889.1| from Bacillus thuringiensis MC28

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|407704304|ref|YP_006827889.1|
Domain Number 1 Region: 2-130
Classification Level Classification E-value
Superfamily Cytidine deaminase-like 3.01e-48
Family Cytidine deaminase 0.0000137
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|407704304|ref|YP_006827889.1|
Sequence length 131
Comment exopolysaccharide biosynthesis protein [Bacillus thuringiensis MC28]
Sequence
MDKKKYIEEANKMLSKAYIPYSKFPVGAALVTKEGKIYTGCNIENASYGLCNCAERTAIF
KAVSEGERDFSYLVITGETDGPISPCGACRQVIAEFCDPKMRVLLTNVKGDEKEVTVEQL
LPGAFTIDDLK
Download sequence
Identical sequences A0A0L1NDF6 A0A1D3PFT5 A0A1V6LH67 A0A242WN29 A0A242X5X7 C2UTY7 C2VAD3 J8KEK1 K0FR63 R8M0E7
gi|407704304|ref|YP_006827889.1| gi|557623874|ref|YP_008785006.1| WP_000358537.1.100095 WP_000358537.1.100771 WP_000358537.1.11380 WP_000358537.1.13113 WP_000358537.1.14084 WP_000358537.1.2407 WP_000358537.1.24792 WP_000358537.1.24969 WP_000358537.1.24992 WP_000358537.1.30144 WP_000358537.1.3196 WP_000358537.1.42182 WP_000358537.1.42747 WP_000358537.1.42941 WP_000358537.1.4453 WP_000358537.1.46586 WP_000358537.1.474 WP_000358537.1.499 WP_000358537.1.52532 WP_000358537.1.54419 WP_000358537.1.55893 WP_000358537.1.5841 WP_000358537.1.60012 WP_000358537.1.64770 WP_000358537.1.66535 WP_000358537.1.70209 WP_000358537.1.75358 WP_000358537.1.75374 WP_000358537.1.77968 WP_000358537.1.84323 WP_000358537.1.86041 WP_000358537.1.89698 WP_000358537.1.93904 WP_000358537.1.94270

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]