SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|407706638|ref|YP_006830223.1| from Bacillus thuringiensis MC28

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|407706638|ref|YP_006830223.1|
Domain Number 1 Region: 153-365
Classification Level Classification E-value
Superfamily Dihydrofolate reductase-like 2.78e-60
Family RibD C-terminal domain-like 0.00000343
Further Details:      
 
Domain Number 2 Region: 12-153
Classification Level Classification E-value
Superfamily Cytidine deaminase-like 1.84e-44
Family Deoxycytidylate deaminase-like 0.00000635
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|407706638|ref|YP_006830223.1|
Sequence length 379
Comment ABC transporter [Bacillus thuringiensis MC28]
Sequence
MIFLGEVKRMTDQEYMRIALQLAKGTSGQTSPNPMVGAVVVKDGNIVGMGAHLRAGEEHA
EVHALHMAGEKAKNATVYVTLEPCSHFGKTPPCCELLIEKGVKRIVIATLDCNPLVSGNG
KKKLEEAGIEVTTGVLETEAVLLNRYFFHYMKTKRPFVTIKTAMSLDGKTATVTGESKWI
TGAEARADVHQYRHTHDAILVGVNTVIADNPHLTTRIPNGGKHSIRVILDTHLRTPPSSH
VITDTLAPTWIIVGKDVNKEKIASYESKNIAIFQMKTKQIEIQDVLDLLGEKQILSLFIE
GGQTVHASFLQTNNFNEIVTYISPKLIGGKGAPTLFGGNGFSKLQDSLSLKIQEMKQIGD
DIKIVATARNEVTKCLQEL
Download sequence
Identical sequences K0FTW3
gi|407706638|ref|YP_006830223.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]