SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|407706854|ref|YP_006830439.1| from Bacillus thuringiensis MC28

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|407706854|ref|YP_006830439.1|
Domain Number 1 Region: 10-148
Classification Level Classification E-value
Superfamily Cytidine deaminase-like 1.37e-40
Family Deoxycytidylate deaminase-like 0.00061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|407706854|ref|YP_006830439.1|
Sequence length 188
Comment sensor histidine kinase [Bacillus thuringiensis MC28]
Sequence
MKNMERISWDQYFMTQSHLLSLRSTCTRLAVGATIVRDKRIIAGGYNGSIKGGVHCIDDG
CYVIDNHCVRTIHAEMNALLQCAKFGAKTEEAEIYVTHFPCLQCCKAIIQSGITAVYYAQ
DYKNHPYAIELFEQANVTVKHVPLEYDIAALEEQKRYTELKELFASFEKDNLSMEELQHV
FTKAKMML
Download sequence
Identical sequences C2V0S2 K0FYQ1
gi|407706854|ref|YP_006830439.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]