SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|407708249|ref|YP_006831834.1| from Bacillus thuringiensis MC28

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|407708249|ref|YP_006831834.1|
Domain Number 1 Region: 206-511
Classification Level Classification E-value
Superfamily Cytidine deaminase-like 2.91e-130
Family AICAR transformylase domain of bifunctional purine biosynthesis enzyme ATIC 0.0000012
Further Details:      
 
Domain Number 2 Region: 2-194
Classification Level Classification E-value
Superfamily Methylglyoxal synthase-like 5.23e-70
Family Inosicase 0.0000123
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|407708249|ref|YP_006831834.1|
Sequence length 511
Comment gp38 [Bacillus thuringiensis MC28]
Sequence
MKKRALVSVSDKTGVVEFVRGLLEQGIEVISTGGTKKLLEENGLQVIGISEVTGFPEIMD
GRVKTLHPNIHGGLLAVRDNETHVAQMNELGIQPIDFVVVNLYPFKETIAKPDVTFADAI
ENIDIGGPTMIRSAAKNHKFVSVIVDPVDYDVVLAELKENGEVKEETKRKLAAKVFRHTA
AYDALISNYLTEQMGEESPETLTVTFEKKQDLRYGENPHQKATFYKAPFAATSSVAYAEQ
LHGKELSYNNINDADAALSIVKEFTEPAVVAVKHMNPCGVGVGTDIHKAYTRAYEADPVS
IFGGIIAANREIDKATAEKLHEIFLEIVIAPSFSQEALEVLQSKKNLRLLTVNIEKATSA
SKKLTSVQGGLLVQEEDTLSLDENTISIPTKREPSEQEWKDLKLAWKVVKHVKSNAIVLA
NDNMTVGVGAGQMNRVGSAKIAITQAGEKAQGSALASDAFFPMPDTVEEAAKAGITAIIQ
PGGSIRDEDSIKMADKYGITMVFTGVRHFKH
Download sequence
Identical sequences A0A2C4FDB7 K0G317
WP_000745447.1.11380 WP_000745447.1.13113 gi|407708249|ref|YP_006831834.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]