SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|459285338|ref|YP_007508443.1| from Lactococcus lactis subsp. lactis IO-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|459285338|ref|YP_007508443.1|
Domain Number 1 Region: 2-125
Classification Level Classification E-value
Superfamily YjgF-like 3.14e-42
Family YjgF/L-PSP 0.0000435
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|459285338|ref|YP_007508443.1|
Sequence length 126
Comment regulatory protein AldR [Lactococcus lactis subsp. lactis IO-1]
Sequence
MKIIATSDAPAAIGPYVQGKIVNGLLYASGQIPLNPLNGEIVGDSIETQTEQVMKNISAI
LKEAHSDFDLVIKTTCFLKNIEDFSRFNAIYSKFFDKEFPARSAVGVAGLPKNVLIEIEV
IAEVKS
Download sequence
Identical sequences A0A0R2N8J0 A0A2A9I6C0 H5SZ53
WP_015426409.1.16671 WP_015426409.1.28005 WP_015426409.1.54010 WP_015426409.1.57644 gi|459285338|ref|YP_007508443.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]