SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|340794487|ref|YP_004759950.1| from Corynebacterium variabile DSM 44702

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|340794487|ref|YP_004759950.1|
Domain Number 1 Region: 115-294,418-587
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 9.16e-100
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000000768
Further Details:      
 
Domain Number 2 Region: 291-413
Classification Level Classification E-value
Superfamily GAD domain-like 5.89e-34
Family GAD domain 0.00048
Further Details:      
 
Domain Number 3 Region: 2-104
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.38e-31
Family Anticodon-binding domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|340794487|ref|YP_004759950.1|
Sequence length 600
Comment aspartyl-tRNA synthetase [Corynebacterium variabile DSM 44702]
Sequence
MLRTHLCGDLRSDDTGKEVTLTGWVARRRDHGGVIFIDLRDRSGLAQVVFRENEVAERAH
DLRSEYCLKVTGIVEARPEGSENPNLASGAIEVNVSDLEILNESTALPFQIEDTTGGEVG
EETRLKYRYLDLRRERQAHALRLRSKVSQAARGVLSGEDFTEIETPTLTRSTPEGARDFL
VPARLRPGSFYALPQSPQLFKQLLMVAGMERYYQIARCYRDEDFRADRQPEFTQLDVEMS
FVDQDDVIALAENILTAVWKEIGYDIQTPIPRMTYAEAMEKYGSDKPDLRFDIQITECTE
FFKDTSFRVFKAPYVGAVVMEGGASQPRRTLDAWQEWAKQRGAKGLAYILVGEDGTLTGP
VAKNITDAEREGIAAHVGAKPGDCIFFGAGEVKPSRALLGAARGEIAERLGLIKEGDWAF
TWVVDAPLFEPAADATASGDVALGHSTWTAVHHAFTSPKPEWIDSFDENPGEATAYAYDI
VCNGNEIGGGSIRIHQRDVQERVFAVMGISEEEAREKFGFLLDAFAFGAPPHGGIAFGWD
RIVSLLGGYESIRDVIAFPKSGGGVDPLTEAPAPITAQQRKEAGIDAKPKKPEAAAPAAE
Download sequence
Identical sequences G0HE10
gi|340794487|ref|YP_004759950.1| WP_014010042.1.39090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]