SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|340795063|ref|YP_004760526.1| from Corynebacterium variabile DSM 44702

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|340795063|ref|YP_004760526.1|
Domain Number 1 Region: 17-213
Classification Level Classification E-value
Superfamily Formyltransferase 9.55e-51
Family Formyltransferase 0.0000294
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|340795063|ref|YP_004760526.1|
Sequence length 216
Comment phosphoribosylglycinamide formyltransferase [Corynebacterium variabile DSM 44702]
Sequence
MPPEVPVQGNLSPTTPLRVVVLTSGEGTLLQSMIDTLDGSVEIVAVGADRPCHALARAAA
AGLDTFLVAYNPDHESGYDRDAWNRRIADAVASRRPDIIVSAGFMRILGAEFVGRFRGRI
INTHPALLPAFPGAHAVEDALAYGVALTGSTVHLVDDGVDTGPIIAQREVPVLRGDTRAS
LHERIKTVERRLIVDVLHRTARYGYTIDGRKVWIND
Download sequence
Identical sequences G0HHH3
gi|340795063|ref|YP_004760526.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]