SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Galma1|128543|estExt_Genewise1.C_350104 from Galerina marginata v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Galma1|128543|estExt_Genewise1.C_350104
Domain Number 1 Region: 138-235
Classification Level Classification E-value
Superfamily POZ domain 0.0000000000000628
Family BTB/POZ domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Galma1|128543|estExt_Genewise1.C_350104
Sequence length 246
Sequence
MDRQAQKALKPLLDSVTESAIRIWQDDMLSLFHDAQNRFPDIVWEMEDGRGGSSEKIWGH
RAIIHARIPSGSQSQGLSMPSHGSTWPDFTSRASIGFRRLEIPLTNGSSYFIDELRYLYT
NQSLIDFQKDSGLNIGRDELQEDLNSMLRSQQYADIEIAVPDRGSPWCVPVVFPSHRFIL
SSRSPYFFRILAQSHEEERNKRSKIALPYSSFTPKSFSFILGYLYSGTLKFTQHEWDLTT
AFYIYR
Download sequence
Identical sequences A0A067SSD0
jgi|Galma1|128543|estExt_Genewise1.C_350104

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]