SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Galma1|252855|fgenesh1_kg.22_#_301_#_Locus662v1rpkm186.81 from Galerina marginata v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Galma1|252855|fgenesh1_kg.22_#_301_#_Locus662v1rpkm186.81
Domain Number 1 Region: 111-642
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.36e-153
Family Calponin-homology domain, CH-domain 0.00000000000763
Further Details:      
 
Domain Number 2 Region: 7-89,134-154
Classification Level Classification E-value
Superfamily EF-hand 0.0000000122
Family Polcalcin 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Galma1|252855|fgenesh1_kg.22_#_301_#_Locus662v1rpkm186.81
Sequence length 646
Sequence
MEAFKLQKKFPEVSRDEMFDLINQFNSLHTDSPGRVDKSAVLQALQSSGQSYDIARETLK
HVSVDASGKVELDDWVELNVKLRSQGKGAITTKAGKVTVQGSNANVSHTLNEDERAEFTN
HINLVIENDPDVNDRYPIPTDTMQLFDECKDGLILSKLINDSVPDTIDTRVLNKPTARKP
LNAFQITENNNIVITSAKGIGCSVVNIGSSDLSEGREHLILGLIWQIIRRGLLAQVDIKL
HPELYRLCEEGETIDDLLRLTPDQILLRWFNYHLKAAGWKRRVNNFSRDVSDGENYTVLL
NQLKPDQCSRAPLQTSDVRTRAEQVLQNADKIGCRKYLTPSSLVAGNPRLNLAFVANLFN
THPGLEPLDEQEAKDYGQVEDFDAEGEREARVFTLWLNSLGVEPGVFNLFENLKDGLVIL
QAFDKILPGSVIWRRVSKPKAGAGQASYASGGADEEEGEDIGVTPNQSTLSRFKAVENTN
YVVDLAKQNGLHMVGIQGADIVDAKKTLVLGLVWQIMRMNITKTLTSLSKTGRPMTDRDM
LSWANTTAQKAKPGVRPIRSFKDPSITTGLFFLDLLDAIRPGIVDPNLVLSVADNGDYED
RRQNAKLAISIARKMNALIFLVPEDIVDVRAKLILTFVGSLMSVAQ
Download sequence
Identical sequences A0A067SP38
jgi|Galma1|252855|fgenesh1_kg.22_#_301_#_Locus662v1rpkm186.81

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]