SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|488599635|ref|YP_007906106.1| from Archaeoglobus sulfaticallidus PM70-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|488599635|ref|YP_007906106.1|
Domain Number 1 Region: 7-68,495-655
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.7e-43
Family Extended AAA-ATPase domain 0.0000103
Further Details:      
 
Domain Number 2 Region: 77-194,476-515
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 3.4e-27
Family Intein (protein splicing domain) 0.025
Further Details:      
 
Domain Number 3 Region: 665-752
Classification Level Classification E-value
Superfamily post-AAA+ oligomerization domain-like 3.44e-23
Family DNA polymerase III clamp loader subunits, C-terminal domain 0.000092
Further Details:      
 
Domain Number 4 Region: 322-388
Classification Level Classification E-value
Superfamily Homing endonucleases 0.00000000000623
Family Intein endonuclease 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|488599635|ref|YP_007906106.1|
Sequence length 765
Comment Intein/homing endonuclease [Archaeoglobus sulfaticallidus PM70-1]
Sequence
MLESEIWVEKYRPKTLDEVVGQHAIVQRLKGYVEKRNIPHLLFAGPPGTGKTASAIALTR
DLFGENWRDNFIEMNASVSKSTPVTVRVNGAVERLTFEDLDRMYFNGCGDDVEYADAGDL
EVLTVDEKYRVRWARVSKIIRHKARKILRVRVEGGGVIELTGNHAVMLLDKNGSLVAKKA
SEIKEGDFFISFVSKLGGSLNKLSFSDYLPRSVTSRVRVIDELEVNELVSWSFGAYAAEG
AVSIRGDTSGQVVYTFGSNELEQIGRIKEFSESLGLKIYETYTSSGFDRSKYSAKQIKVL
STQLAKFVRDNFYDGYGFKAKNKRIPGFVYELPFEAKMAFLRGLADGDGYGEWANIVRIS
SASKDLLIDVAWLSRMTGIESSIFDREVRLIWKGGMGYQKSELLPAEIFVNFFERISDKI
EGNWRYEMRHQLYENRKTVSKQTLKKILDMVDVESLTEKEKEVLKNLRNLVNSDLHVLRV
REIEAVDYNDFVYDVSVPGNEMFFAGNVPVLLHNSDERGIDVVRHKIKEFARTAPIGDAP
FKIIFLDEADALTADAQAALRRTMEMYSKICRFILSCNYVSRIIEPIQSRCAVFKFRPIS
EEAMKKKLLEICEKENVEITEDGLQALIYVSGGDFRKAINALQGAATFGEKIDAEVIFQI
TATARPEEVKDLLELALSGNFLEAREKLEHLLIEYGMSGEDVVNQLFKEIISSSLDERLK
VVLIDKLGEIDFRLTEGSNERIQLDAYLAFLSTIAKRKKEKVEKE
Download sequence
Identical sequences N0BAU1
gi|488599635|ref|YP_007906106.1| WP_015589712.1.93643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]