SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|488601559|ref|YP_007908030.1| from Archaeoglobus sulfaticallidus PM70-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|488601559|ref|YP_007908030.1|
Domain Number 1 Region: 1-107
Classification Level Classification E-value
Superfamily GlnB-like 6.04e-39
Family Prokaryotic signal transducing protein 0.0000515
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|488601559|ref|YP_007908030.1|
Sequence length 110
Comment nitrogen regulatory protein P-II family [Archaeoglobus sulfaticallidus PM70-1]
Sequence
MKKIEAIIRPEKLECVKKALEESGYVAMTVTEVKGRGEQKGIKLQFRGREVDVDFLQKTK
IEIVAEDKDVDRIIDIITSSARTGKYGDGRIFVLPVEKSVKIRTGEEVSE
Download sequence
Identical sequences N0BID0
WP_015591633.1.93643 gi|488601559|ref|YP_007908030.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]