SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|488601766|ref|YP_007908237.1| from Archaeoglobus sulfaticallidus PM70-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|488601766|ref|YP_007908237.1|
Domain Number 1 Region: 2-116
Classification Level Classification E-value
Superfamily DsrC, the gamma subunit of dissimilatory sulfite reductase 1.06e-39
Family DsrC, the gamma subunit of dissimilatory sulfite reductase 0.0000388
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|488601766|ref|YP_007908237.1|
Sequence length 116
Comment Dissimilatory sulfite reductase (desulfoviridin), gamma subunit [Archaeoglobus sulfaticallidus PM70-1]
Sequence
MPEIEVKGRKLLLDEDGFLQDWEEWDEDVAKALAADDRWTGAKVELTDEHWEIIRFLRSY
YEKYGVAPPIRILVKEVKKAFGPEKGNLKYLYKLFPQGPAKDACRIAGLPKPTGCV
Download sequence
Identical sequences N0BF08
WP_015591840.1.93643 gi|488601766|ref|YP_007908237.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]