SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|488601522|ref|YP_007907993.1| from Archaeoglobus sulfaticallidus PM70-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|488601522|ref|YP_007907993.1|
Domain Number 1 Region: 4-36
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.0000306
Family Transcriptional factor domain 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|488601522|ref|YP_007907993.1|
Sequence length 60
Comment hypothetical protein Asulf_02036 [Archaeoglobus sulfaticallidus PM70-1]
Sequence
MKKFLVCPVCNSKDVEPDTGGYTGKYHCKNCGYIGSFILKMDEGEYNELMERERKEKSDL
Download sequence
Identical sequences N0BNU6
WP_015591596.1.93643 gi|488601522|ref|YP_007907993.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]