SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|481851090|ref|YP_007875530.1| from Raoultella ornithinolytica B6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|481851090|ref|YP_007875530.1|
Domain Number 1 Region: 344-428
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 4.91e-24
Family CorC/HlyC domain-like 0.0000432
Further Details:      
 
Domain Number 2 Region: 200-335
Classification Level Classification E-value
Superfamily CBS-domain pair 5.82e-22
Family CBS-domain pair 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|481851090|ref|YP_007875530.1|
Sequence length 447
Comment hypothetical protein RORB6_16485 [Raoultella ornithinolytica B6]
Sequence
MLNSILVILCLIAVSAFFSISEISLAASRKIKLKLLADDGNVNAQRVLKMQENPGTFFTV
VQIGLNAVAILGGIVGDAAFSPAFHSLLSQYMSAELSEQLSFIISFTLVTSLFILFADLT
PKRIGMIAPEAVALRIINPMRFCLLVFRPLVWLFNGMANNIFRLFKIPMVRKDDITSDDI
YAVVEAGALAGVLRKQEHELIENVFELESRTVPSSMTSRENIIWFDLHEDEQSLKNKVAE
HPHSKFLVCNEDIDHIIGYVDSKDLLNRVLANQSLVLTGGVQIRNTLIVPDTLTLSEALE
SFKTAGEDFAVIMNEYALVVGIITLNDVMTTLMGDLVGQGLEEQIVARDENSWLIDGGTP
IDDVMRVLDIDEFPQSGNYETIGGFMMFMLRKIPKRTDAVKFSGYKFEVVDIDNYRIDQL
LVTRIDNKPTVLVPKQPDAANSDKEPA
Download sequence
Identical sequences A0A181XZG8 A0A1Y6GNH4
WP_004857167.1.101156 WP_004857167.1.10794 WP_004857167.1.12945 WP_004857167.1.24033 WP_004857167.1.31814 WP_004857167.1.36155 WP_004857167.1.45641 WP_004857167.1.46490 WP_004857167.1.48193 WP_004857167.1.5121 WP_004857167.1.58262 WP_004857167.1.62461 WP_004857167.1.68510 WP_004857167.1.74703 WP_004857167.1.76415 WP_004857167.1.82322 WP_004857167.1.9560 WP_004857167.1.97684 gi|481851090|ref|YP_007875530.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]