SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|481852702|ref|YP_007877142.1| from Raoultella ornithinolytica B6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|481852702|ref|YP_007877142.1|
Domain Number 1 Region: 162-299
Classification Level Classification E-value
Superfamily CBS-domain pair 1.89e-22
Family CBS-domain pair 0.0041
Further Details:      
 
Domain Number 2 Region: 310-394
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 2.64e-21
Family CorC/HlyC domain-like 0.00014
Further Details:      
 
Weak hits

Sequence:  gi|481852702|ref|YP_007877142.1|
Domain Number - Region: 31-120
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.0746
Family LacY-like proton/sugar symporter 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|481852702|ref|YP_007877142.1|
Sequence length 398
Comment hypothetical protein RORB6_24550 [Raoultella ornithinolytica B6]
Sequence
MTLNRYRLRHMAKQGNRQAKRVEKLLRKPDRLISLVLIGNNLVNILASALGTIVGMRLYG
DAGVAIATGVLTFVVLVFAEVLPKTIAALYPEKVAYPSSFLLAPLQVLMMPLVWLLNTIT
RLLMRMMGIKTDIIVSGALSKDELRTIVNESRTQISRRNQDMLLSVLDLEKVSVNDIMVP
RNEIIGIDINDDWKSIVRQLTHSPHGRIVLYRGSLDDAISMLRVREAYRLMTEKKEFTKE
VMLRAADEIYFVPEGTPLSTQLVKFQRNKKKVGLVVDEYGDIQGLVTVEDILEEIVGDFT
TSMSPTLAEEVTPLTDGTVIIDGSANVREINKAFNWHLPEDEARTVNGIILEALEEIPVP
GTRVRIEQYDIDILDVQDNMIKQVKVKPVKPLRESAAE
Download sequence
Identical sequences gi|481852702|ref|YP_007877142.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]