SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|389841481|ref|YP_006343565.1| from Cronobacter sakazakii ES15

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|389841481|ref|YP_006343565.1|
Domain Number 1 Region: 4-95
Classification Level Classification E-value
Superfamily YccV-like 1.57e-29
Family YccV-like 0.00000512
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|389841481|ref|YP_006343565.1|
Sequence length 105
Comment heat shock protein HspQ [Cronobacter sakazakii ES15]
Sequence
MIASKFGIGQQVRHSLLGYLGVVVDIDPEYSLDEPEVDELAVNAELRAAPWYHVVMEDDD
GQPVHTYLAEAQLSGEMQEEHPEQPSMDELARSIRQQLQAPRLRN
Download sequence
Identical sequences A0A0F6YE52 A0A0K2PEH7 A0A0U3R1D0 A7ME45 K8AFB2 K8BYG9 K8CB20 K8CMD6 V5U1R5
WP_004385415.1.100123 WP_004385415.1.100327 WP_004385415.1.10743 WP_004385415.1.11201 WP_004385415.1.11729 WP_004385415.1.14450 WP_004385415.1.14471 WP_004385415.1.17416 WP_004385415.1.1762 WP_004385415.1.19250 WP_004385415.1.21817 WP_004385415.1.22032 WP_004385415.1.22106 WP_004385415.1.22333 WP_004385415.1.2234 WP_004385415.1.22982 WP_004385415.1.23247 WP_004385415.1.24568 WP_004385415.1.24976 WP_004385415.1.25078 WP_004385415.1.25268 WP_004385415.1.26488 WP_004385415.1.26514 WP_004385415.1.27389 WP_004385415.1.28222 WP_004385415.1.29051 WP_004385415.1.29215 WP_004385415.1.29380 WP_004385415.1.29613 WP_004385415.1.2985 WP_004385415.1.30214 WP_004385415.1.30537 WP_004385415.1.34134 WP_004385415.1.34426 WP_004385415.1.34483 WP_004385415.1.34712 WP_004385415.1.35522 WP_004385415.1.360 WP_004385415.1.36841 WP_004385415.1.37109 WP_004385415.1.3715 WP_004385415.1.37555 WP_004385415.1.38143 WP_004385415.1.38225 WP_004385415.1.39049 WP_004385415.1.39163 WP_004385415.1.39729 WP_004385415.1.40036 WP_004385415.1.40344 WP_004385415.1.41665 WP_004385415.1.42223 WP_004385415.1.42482 WP_004385415.1.44053 WP_004385415.1.45774 WP_004385415.1.46181 WP_004385415.1.48341 WP_004385415.1.48528 WP_004385415.1.48540 WP_004385415.1.48695 WP_004385415.1.4870 WP_004385415.1.49393 WP_004385415.1.49554 WP_004385415.1.4995 WP_004385415.1.50354 WP_004385415.1.5082 WP_004385415.1.51998 WP_004385415.1.52367 WP_004385415.1.5266 WP_004385415.1.53601 WP_004385415.1.54721 WP_004385415.1.54861 WP_004385415.1.55414 WP_004385415.1.56053 WP_004385415.1.57355 WP_004385415.1.58258 WP_004385415.1.59680 WP_004385415.1.60338 WP_004385415.1.60586 WP_004385415.1.61601 WP_004385415.1.6185 WP_004385415.1.62605 WP_004385415.1.62682 WP_004385415.1.63198 WP_004385415.1.63385 WP_004385415.1.6369 WP_004385415.1.6429 WP_004385415.1.65768 WP_004385415.1.67106 WP_004385415.1.67166 WP_004385415.1.67391 WP_004385415.1.68091 WP_004385415.1.68410 WP_004385415.1.69145 WP_004385415.1.69775 WP_004385415.1.69840 WP_004385415.1.70246 WP_004385415.1.70259 WP_004385415.1.70784 WP_004385415.1.72434 WP_004385415.1.72500 WP_004385415.1.72972 WP_004385415.1.75231 WP_004385415.1.75988 WP_004385415.1.77541 WP_004385415.1.7843 WP_004385415.1.7880 WP_004385415.1.78906 WP_004385415.1.8152 WP_004385415.1.82482 WP_004385415.1.83282 WP_004385415.1.84145 WP_004385415.1.84278 WP_004385415.1.8442 WP_004385415.1.84685 WP_004385415.1.84694 WP_004385415.1.85350 WP_004385415.1.85926 WP_004385415.1.8619 WP_004385415.1.86449 WP_004385415.1.86471 WP_004385415.1.86965 WP_004385415.1.8726 WP_004385415.1.8793 WP_004385415.1.88335 WP_004385415.1.88807 WP_004385415.1.88830 WP_004385415.1.89078 WP_004385415.1.89683 WP_004385415.1.90251 WP_004385415.1.90576 WP_004385415.1.90986 WP_004385415.1.91071 WP_004385415.1.91115 WP_004385415.1.9156 WP_004385415.1.92291 WP_004385415.1.92451 WP_004385415.1.93037 WP_004385415.1.93581 WP_004385415.1.93704 WP_004385415.1.94111 WP_004385415.1.94351 WP_004385415.1.9447 WP_004385415.1.94763 WP_004385415.1.95253 WP_004385415.1.95290 WP_004385415.1.95648 WP_004385415.1.97779 WP_004385415.1.98129 WP_004385415.1.98221 WP_004385415.1.98853 WP_004385415.1.99500 WP_004385415.1.99856 gi|565646054|ref|YP_008897350.1| gi|449308736|ref|YP_007441092.1| gi|389841481|ref|YP_006343565.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]