SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|389842682|ref|YP_006344766.1| from Cronobacter sakazakii ES15

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|389842682|ref|YP_006344766.1|
Domain Number 1 Region: 52-156
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 1.31e-39
Family Frataxin-like 0.00000115
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|389842682|ref|YP_006344766.1|
Sequence length 157
Comment frataxin-like protein [Cronobacter sakazakii ES15]
Sequence
MFIHLFSIIAGEDAKARVCVTPDDTKAVPPAGFYSRLLLLYCRHRVQQETNMNDSEFHRL
ADGLWMTIEERLDAWDGDSDIDCEINGGVLTLSFENGSKIIINRQEPLHQVWLATKQGGY
HFDYKNDEWICDRSGERFWDLLETAATQQAGEAVSFR
Download sequence
Identical sequences A0A0F6YBE9 K8CVP7 V5U3Z9
gi|389842682|ref|YP_006344766.1| gi|565647365|ref|YP_008898661.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]