SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384127900|ref|YP_005510514.1| from Yersinia pestis D182038

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384127900|ref|YP_005510514.1|
Domain Number 1 Region: 1-56,114-370
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.87e-41
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0013
Further Details:      
 
Domain Number 2 Region: 353-471
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 1.72e-25
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|384127900|ref|YP_005510514.1|
Sequence length 487
Comment dihydrolipoamide dehydrogenase [Yersinia pestis D182038]
Sequence
MKTLNVDVAVIGGGTAGLGAYRAAKLLTPNVVMIEGGEYGTTCARVGCMPSKLLIAAAEA
VHQIEKAPGFGIHPQGKPLINGREVMDRVKRERDRFVGFVLESVETIPAADKIQGYARFI
DDNTLQVDDHTQLTSQKIIAQRIVIATGSRPSWPASWNELGDRLIINDDVFNWDDLPESV
AVFGPGVIGLELGQALHRLGVQVKMFGVGGAVGPLTDSIVRDYAAKTLGDEFYLDPDVKV
ELMQREGDKVFIRYLDKSGRPQEIMVDYVLAATGRRPNVDKLGLENTSLILDERGVPQAD
RLTMQTNVPHIFIAGDASNQLPLLHEASDQARIAGVNAGGFPEVVPGLRRSPISVVFSDP
QIAMVGATFRELAQKFSACGCFEIGEVSFENQGRSRVMLKNKGILRIYGEQGTGRFLGAE
MMGPSAEHIAHLLAWAHQQQMTIDQMLDMPFYHPVIEEGLRTALRDLQSKLKLGADEAER
CLRCPGE
Download sequence
Identical sequences A0A0E1P1U6 A0A0H2YF48 A0A0M1VAT5 A0A208RWC8 Q0WA96 Q7CL12
WP_002209480.1.100246 WP_002209480.1.100921 WP_002209480.1.100931 WP_002209480.1.10105 WP_002209480.1.101305 WP_002209480.1.101382 WP_002209480.1.101928 WP_002209480.1.102012 WP_002209480.1.102067 WP_002209480.1.10955 WP_002209480.1.12463 WP_002209480.1.12857 WP_002209480.1.14063 WP_002209480.1.14804 WP_002209480.1.15321 WP_002209480.1.15605 WP_002209480.1.15689 WP_002209480.1.16333 WP_002209480.1.17135 WP_002209480.1.17873 WP_002209480.1.17983 WP_002209480.1.18640 WP_002209480.1.18826 WP_002209480.1.19739 WP_002209480.1.20035 WP_002209480.1.2064 WP_002209480.1.21486 WP_002209480.1.21879 WP_002209480.1.21934 WP_002209480.1.22530 WP_002209480.1.22542 WP_002209480.1.22708 WP_002209480.1.23157 WP_002209480.1.23271 WP_002209480.1.23811 WP_002209480.1.24002 WP_002209480.1.25394 WP_002209480.1.2640 WP_002209480.1.26776 WP_002209480.1.26960 WP_002209480.1.27251 WP_002209480.1.2726 WP_002209480.1.28647 WP_002209480.1.28922 WP_002209480.1.29157 WP_002209480.1.29355 WP_002209480.1.2947 WP_002209480.1.31496 WP_002209480.1.31739 WP_002209480.1.31805 WP_002209480.1.32343 WP_002209480.1.32388 WP_002209480.1.32446 WP_002209480.1.33203 WP_002209480.1.33937 WP_002209480.1.34031 WP_002209480.1.35389 WP_002209480.1.35538 WP_002209480.1.36088 WP_002209480.1.37863 WP_002209480.1.38147 WP_002209480.1.38743 WP_002209480.1.39066 WP_002209480.1.39346 WP_002209480.1.40071 WP_002209480.1.40134 WP_002209480.1.40853 WP_002209480.1.41196 WP_002209480.1.42490 WP_002209480.1.44598 WP_002209480.1.44603 WP_002209480.1.44832 WP_002209480.1.45214 WP_002209480.1.46262 WP_002209480.1.46545 WP_002209480.1.46686 WP_002209480.1.4678 WP_002209480.1.46891 WP_002209480.1.47387 WP_002209480.1.48166 WP_002209480.1.48722 WP_002209480.1.4889 WP_002209480.1.49906 WP_002209480.1.4997 WP_002209480.1.50010 WP_002209480.1.50093 WP_002209480.1.50106 WP_002209480.1.50984 WP_002209480.1.51293 WP_002209480.1.51588 WP_002209480.1.51934 WP_002209480.1.52158 WP_002209480.1.52247 WP_002209480.1.52734 WP_002209480.1.52819 WP_002209480.1.53300 WP_002209480.1.53838 WP_002209480.1.53848 WP_002209480.1.53953 WP_002209480.1.54568 WP_002209480.1.54951 WP_002209480.1.55194 WP_002209480.1.55695 WP_002209480.1.5592 WP_002209480.1.56912 WP_002209480.1.56953 WP_002209480.1.57585 WP_002209480.1.57657 WP_002209480.1.58067 WP_002209480.1.58794 WP_002209480.1.59102 WP_002209480.1.59431 WP_002209480.1.5957 WP_002209480.1.59635 WP_002209480.1.59687 WP_002209480.1.59789 WP_002209480.1.60437 WP_002209480.1.61689 WP_002209480.1.62232 WP_002209480.1.62342 WP_002209480.1.63387 WP_002209480.1.64142 WP_002209480.1.64474 WP_002209480.1.64780 WP_002209480.1.64786 WP_002209480.1.64910 WP_002209480.1.653 WP_002209480.1.65400 WP_002209480.1.65554 WP_002209480.1.65706 WP_002209480.1.65718 WP_002209480.1.6581 WP_002209480.1.66118 WP_002209480.1.66546 WP_002209480.1.66616 WP_002209480.1.67404 WP_002209480.1.68361 WP_002209480.1.68855 WP_002209480.1.69018 WP_002209480.1.69316 WP_002209480.1.69951 WP_002209480.1.70171 WP_002209480.1.70319 WP_002209480.1.70377 WP_002209480.1.70417 WP_002209480.1.70726 WP_002209480.1.7083 WP_002209480.1.7169 WP_002209480.1.71744 WP_002209480.1.72440 WP_002209480.1.74577 WP_002209480.1.75173 WP_002209480.1.7518 WP_002209480.1.75407 WP_002209480.1.75689 WP_002209480.1.75821 WP_002209480.1.77387 WP_002209480.1.77429 WP_002209480.1.77691 WP_002209480.1.7841 WP_002209480.1.78556 WP_002209480.1.79515 WP_002209480.1.79550 WP_002209480.1.79609 WP_002209480.1.79981 WP_002209480.1.80331 WP_002209480.1.81848 WP_002209480.1.81877 WP_002209480.1.8210 WP_002209480.1.82151 WP_002209480.1.82270 WP_002209480.1.82619 WP_002209480.1.8303 WP_002209480.1.83265 WP_002209480.1.8420 WP_002209480.1.84703 WP_002209480.1.84720 WP_002209480.1.85269 WP_002209480.1.8559 WP_002209480.1.85802 WP_002209480.1.86034 WP_002209480.1.86413 WP_002209480.1.8728 WP_002209480.1.87418 WP_002209480.1.87853 WP_002209480.1.87988 WP_002209480.1.88362 WP_002209480.1.88472 WP_002209480.1.8964 WP_002209480.1.90176 WP_002209480.1.9051 WP_002209480.1.91844 WP_002209480.1.92331 WP_002209480.1.92604 WP_002209480.1.927 WP_002209480.1.9311 WP_002209480.1.9320 WP_002209480.1.93928 WP_002209480.1.93933 WP_002209480.1.94052 WP_002209480.1.94201 WP_002209480.1.94545 WP_002209480.1.94683 WP_002209480.1.95981 WP_002209480.1.97245 WP_002209480.1.97375 WP_002209480.1.97448 WP_002209480.1.97791 WP_002209480.1.97872 WP_002209480.1.97894 WP_002209480.1.99109 WP_002209480.1.99383 WP_002209480.1.9941 WP_002209480.1.99416 WP_002209480.1.99788 WP_002209480.1.99990 YP_002348792.1.25044 gi|384138229|ref|YP_005520931.1| gi|294505567|ref|YP_003569629.1| gi|22124235|ref|NP_667658.1| gi|384127900|ref|YP_005510514.1| gi|108806103|ref|YP_650019.1| gi|384124038|ref|YP_005506658.1| gi|108810216|ref|YP_645983.1| gi|218930917|ref|YP_002348792.1| gi|384412981|ref|YP_005622343.1| 187410.y0318 214092.YPO3917 360102.YPA_0105 377628.YPN_0050

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]