SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|384124617|ref|YP_005507231.1| from Yersinia pestis D182038

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|384124617|ref|YP_005507231.1|
Domain Number 1 Region: 632-808
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.3e-44
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0034
Further Details:      
 
Domain Number 2 Region: 2-310
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 9.61e-40
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0027
Further Details:      
 
Domain Number 3 Region: 501-626
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 9.6e-32
Family Duplicated SiR/NiR-like domains 1 and 3 0.011
Further Details:      
 
Weak hits

Sequence:  gi|384124617|ref|YP_005507231.1|
Domain Number - Region: 346-400
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.0575
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|384124617|ref|YP_005507231.1|
Sequence length 848
Comment nitrite reductase [Yersinia pestis D182038]
Sequence
MSKIKIAIIGNGMVGHRFIEDLLDKADKDQFDITVFCEEPRIAYDRVHLSSYFSHHTAEE
LSLVREGFYEKQGVKVLVGERAITINRAEKVIHSNSGRSLYYDKLVMATGSYPWIPPIKG
SEGQDCFVYRTIEDLNAIEACTRRSKRGAVIGGGLLGLEAAGALKSLGVETHVIEFAPVL
MAEQLDPMGGDQLRQKIERMGVRVHTGKNTQEIVHSGQNSRKTMLFADGTQLEVDFIVFS
TGIRPQDKLANQCGLATARRGGIAINDYCQTSDPDVYAIGECASWQERTFGLVAPGYKMA
QVAADHLLGRENAFLGADMSAKLKLLGVDVGGIGDAHGRTEGARSYVYLDESKEIYKRLV
VSADNKTLLGAVLVGDTTDYGNLLQLALNNITLPENPDSLILPAHAGNKPTIGVDSLPDS
AQICSCFDVTKGDIIRAIGQGCQTVAALKSATKAGTGCGGCIPLVTQVLNAELSKQGIEV
NNHLCEHFAYSRQELYHLIRVEGIKTFTELREKYGKGYGCEVCKPTVGSLLASCWNEYVL
EPQHTPLQDTNDNFLGNIQKDGTYSIIPRSPGGEITPDGLLVVGQIAKEYNLYTKLTGSQ
RIGMFGAQKDDLPAIWARLIDAGFETGHAYAKALRMAKTCVGSTWCRFGVGDSVGFGVAL
EHRYKGIRAPHKIKFGISGCTRECAEAQGKDVGIIATENGWNLYVCGNGGMKPRHADLLA
ADLDEETLMRYLDRFMMFYIRTADKLQRTSVWLESLEGGIRYLQLVILEDKLGINDQLEA
EIARLRDKVACEWKATVENPAAQVRFAHFINSSLRDPNVQVVREREQHRPARPDERIPVR
VLELEDNA
Download sequence
Identical sequences A0A0E1NTX4 A0A0H2YNF5 A0A0M1VCQ0 A0A208S9A5 Q0WKE1 Q7CFW0
gi|45440025|ref|NP_991564.1| gi|384137859|ref|YP_005520561.1| gi|218927372|ref|YP_002345247.1| gi|22127815|ref|NP_671238.1| gi|384120734|ref|YP_005503354.1| gi|294502250|ref|YP_003566312.1| gi|384124617|ref|YP_005507231.1| 187410.y3945 214092.YPO0161 229193.YP_0163 360102.YPA_3308 377628.YPN_3903 386656.YPDSF_0088 gi|108809299|ref|YP_653215.1| gi|384412792|ref|YP_005622154.1| gi|108814063|ref|YP_649830.1| IDP00411 gi|145597411|ref|YP_001161486.1| WP_002208886.1.100083 WP_002208886.1.100246 WP_002208886.1.100921 WP_002208886.1.100931 WP_002208886.1.10105 WP_002208886.1.101305 WP_002208886.1.101382 WP_002208886.1.101928 WP_002208886.1.102067 WP_002208886.1.10736 WP_002208886.1.10935 WP_002208886.1.10955 WP_002208886.1.11693 WP_002208886.1.12463 WP_002208886.1.12857 WP_002208886.1.1388 WP_002208886.1.14063 WP_002208886.1.14804 WP_002208886.1.15321 WP_002208886.1.15555 WP_002208886.1.15605 WP_002208886.1.16243 WP_002208886.1.16333 WP_002208886.1.17135 WP_002208886.1.17141 WP_002208886.1.17608 WP_002208886.1.17873 WP_002208886.1.17983 WP_002208886.1.18208 WP_002208886.1.18640 WP_002208886.1.18826 WP_002208886.1.19425 WP_002208886.1.19739 WP_002208886.1.19763 WP_002208886.1.20035 WP_002208886.1.2064 WP_002208886.1.21486 WP_002208886.1.21784 WP_002208886.1.21879 WP_002208886.1.21934 WP_002208886.1.22542 WP_002208886.1.22708 WP_002208886.1.23157 WP_002208886.1.23271 WP_002208886.1.23687 WP_002208886.1.23811 WP_002208886.1.24002 WP_002208886.1.2451 WP_002208886.1.25181 WP_002208886.1.25394 WP_002208886.1.2640 WP_002208886.1.26776 WP_002208886.1.26960 WP_002208886.1.27124 WP_002208886.1.27251 WP_002208886.1.2726 WP_002208886.1.28647 WP_002208886.1.28922 WP_002208886.1.29157 WP_002208886.1.29355 WP_002208886.1.2947 WP_002208886.1.29622 WP_002208886.1.2964 WP_002208886.1.29685 WP_002208886.1.29814 WP_002208886.1.3092 WP_002208886.1.30931 WP_002208886.1.311 WP_002208886.1.31336 WP_002208886.1.31496 WP_002208886.1.31739 WP_002208886.1.31805 WP_002208886.1.32343 WP_002208886.1.32388 WP_002208886.1.32446 WP_002208886.1.33937 WP_002208886.1.34031 WP_002208886.1.34138 WP_002208886.1.35389 WP_002208886.1.35538 WP_002208886.1.36088 WP_002208886.1.37174 WP_002208886.1.37494 WP_002208886.1.37863 WP_002208886.1.38147 WP_002208886.1.38235 WP_002208886.1.38743 WP_002208886.1.38824 WP_002208886.1.38993 WP_002208886.1.39066 WP_002208886.1.39346 WP_002208886.1.3976 WP_002208886.1.40071 WP_002208886.1.40134 WP_002208886.1.40853 WP_002208886.1.41196 WP_002208886.1.42490 WP_002208886.1.44408 WP_002208886.1.44598 WP_002208886.1.44603 WP_002208886.1.44832 WP_002208886.1.45198 WP_002208886.1.45214 WP_002208886.1.46262 WP_002208886.1.46545 WP_002208886.1.46686 WP_002208886.1.46731 WP_002208886.1.4678 WP_002208886.1.46891 WP_002208886.1.47387 WP_002208886.1.47440 WP_002208886.1.48166 WP_002208886.1.48722 WP_002208886.1.4889 WP_002208886.1.49906 WP_002208886.1.4997 WP_002208886.1.50010 WP_002208886.1.50093 WP_002208886.1.50106 WP_002208886.1.50984 WP_002208886.1.51284 WP_002208886.1.51293 WP_002208886.1.51588 WP_002208886.1.51772 WP_002208886.1.51934 WP_002208886.1.52158 WP_002208886.1.52247 WP_002208886.1.52734 WP_002208886.1.52819 WP_002208886.1.52969 WP_002208886.1.53300 WP_002208886.1.53838 WP_002208886.1.53848 WP_002208886.1.53953 WP_002208886.1.54568 WP_002208886.1.54951 WP_002208886.1.55194 WP_002208886.1.55695 WP_002208886.1.5592 WP_002208886.1.56031 WP_002208886.1.56912 WP_002208886.1.56953 WP_002208886.1.57585 WP_002208886.1.57657 WP_002208886.1.58067 WP_002208886.1.58794 WP_002208886.1.59102 WP_002208886.1.59431 WP_002208886.1.5957 WP_002208886.1.59635 WP_002208886.1.59687 WP_002208886.1.59789 WP_002208886.1.59885 WP_002208886.1.60437 WP_002208886.1.60707 WP_002208886.1.60896 WP_002208886.1.61689 WP_002208886.1.62232 WP_002208886.1.62342 WP_002208886.1.6270 WP_002208886.1.63387 WP_002208886.1.64142 WP_002208886.1.64474 WP_002208886.1.64780 WP_002208886.1.64910 WP_002208886.1.653 WP_002208886.1.65400 WP_002208886.1.65554 WP_002208886.1.6570 WP_002208886.1.65718 WP_002208886.1.6581 WP_002208886.1.66118 WP_002208886.1.66546 WP_002208886.1.66616 WP_002208886.1.67850 WP_002208886.1.68361 WP_002208886.1.68855 WP_002208886.1.69018 WP_002208886.1.69316 WP_002208886.1.69951 WP_002208886.1.70171 WP_002208886.1.70319 WP_002208886.1.70377 WP_002208886.1.70726 WP_002208886.1.7083 WP_002208886.1.7169 WP_002208886.1.71744 WP_002208886.1.72440 WP_002208886.1.72486 WP_002208886.1.7402 WP_002208886.1.74131 WP_002208886.1.74310 WP_002208886.1.74738 WP_002208886.1.75173 WP_002208886.1.7518 WP_002208886.1.75337 WP_002208886.1.75407 WP_002208886.1.75636 WP_002208886.1.75689 WP_002208886.1.75821 WP_002208886.1.76670 WP_002208886.1.77387 WP_002208886.1.77429 WP_002208886.1.77691 WP_002208886.1.78004 WP_002208886.1.7841 WP_002208886.1.78556 WP_002208886.1.79515 WP_002208886.1.79550 WP_002208886.1.79609 WP_002208886.1.79981 WP_002208886.1.8009 WP_002208886.1.80331 WP_002208886.1.81848 WP_002208886.1.81877 WP_002208886.1.8210 WP_002208886.1.82133 WP_002208886.1.82151 WP_002208886.1.82270 WP_002208886.1.82619 WP_002208886.1.8303 WP_002208886.1.83039 WP_002208886.1.83265 WP_002208886.1.8420 WP_002208886.1.84703 WP_002208886.1.84720 WP_002208886.1.85269 WP_002208886.1.85270 WP_002208886.1.8559 WP_002208886.1.85802 WP_002208886.1.86034 WP_002208886.1.86413 WP_002208886.1.87107 WP_002208886.1.8728 WP_002208886.1.87418 WP_002208886.1.8762 WP_002208886.1.87853 WP_002208886.1.87988 WP_002208886.1.88362 WP_002208886.1.88472 WP_002208886.1.89359 WP_002208886.1.8964 WP_002208886.1.9051 WP_002208886.1.90624 WP_002208886.1.91373 WP_002208886.1.91844 WP_002208886.1.92030 WP_002208886.1.92331 WP_002208886.1.92604 WP_002208886.1.927 WP_002208886.1.9311 WP_002208886.1.9320 WP_002208886.1.93623 WP_002208886.1.93928 WP_002208886.1.93933 WP_002208886.1.94052 WP_002208886.1.94201 WP_002208886.1.94683 WP_002208886.1.95746 WP_002208886.1.95981 WP_002208886.1.97245 WP_002208886.1.97375 WP_002208886.1.97448 WP_002208886.1.97791 WP_002208886.1.97864 WP_002208886.1.97872 WP_002208886.1.97894 WP_002208886.1.99109 WP_002208886.1.99383 WP_002208886.1.9941 WP_002208886.1.99416 WP_002208886.1.99788 WP_002208886.1.99990 YP_002345247.1.25044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]