SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|560127988|ref|YP_008829129.1| from Bacillus subtilis PY79

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|560127988|ref|YP_008829129.1|
Domain Number 1 Region: 201-338
Classification Level Classification E-value
Superfamily CBS-domain pair 1.07e-28
Family CBS-domain pair 0.0017
Further Details:      
 
Domain Number 2 Region: 349-430
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 2.15e-16
Family CorC/HlyC domain-like 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|560127988|ref|YP_008829129.1|
Sequence length 441
Comment UPF0053 protein yhdP [Bacillus subtilis PY79]
Sequence
MNLILVAVLIALTAFFVASEFAIIRIRGSRIDQLIAEGNKAAIAVKKVTTHLDEYLSACQ
LGITLTSIGLGVLGESTIERLLHPLFVQMNVPGSLSHVISFIFAYAIITFLHVVVGELAP
KTVAIQKAEAVSMLFAKPLIWFYRIAFPFIWLLNNSARLLTKAFGLETVSENELAHSEEE
LRIILSESYKSGEINQSEFKYVNKIFEFDDRLAKEIMIPRTEIVSLPHDIKISEMMDIIQ
IEKYTRYPVEEGDKDNIIGVINIKEVLTACISGEVSVDSTISQFVNPIIHVIESAPIQDL
LVKMQKERVHMAILSDEYGGTAGLVTVEDIIEEIVGEIRDEFDIDEISEIRKIGEGHYIL
DGKVLIDQVNDLLGIHLENEEVDTIGGWFLTQKYDVEKDDSIIEEGCEFIINEIDGHHVA
YIEVKKLQEEELLETANQQEA
Download sequence
Identical sequences A0A0C3LBS1 D4G6Z2 G4EYE5 M4KR75
gi|560127988|ref|YP_008829129.1| gi|449093656|ref|YP_007426147.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]