SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|560127992|ref|YP_008829133.1| from Bacillus subtilis PY79

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|560127992|ref|YP_008829133.1|
Domain Number 1 Region: 207-352
Classification Level Classification E-value
Superfamily CBS-domain pair 9.85e-29
Family CBS-domain pair 0.0045
Further Details:      
 
Domain Number 2 Region: 355-429
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 0.00000000000000273
Family CorC/HlyC domain-like 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|560127992|ref|YP_008829133.1|
Sequence length 461
Comment UPF0053 protein yhdT [Bacillus subtilis PY79]
Sequence
MDDIDSLILIGVLIALTAFFVASEFAIVRVRRSRIDQLITEGNKRAILARRVITDLDEYL
SASQLGITLTSIGLGVLGEPAFERLLHPLFEPLGLPDSVSHAVSFAVAYGLITFLHVVVG
ELAPKTVAIQKAEQLTLLIAGPLRLFYLLLFPFIWILNGSARLLCGMFGLKPASEHDGSH
SEEELRMLLSESLKNGEINPSEYKYVNKIFEFDNRIAKEIMIPRKEMAAVSTEMTMAEML
EVMLKEKYTRWPVTDGDKDSVLGLVNTKHLFSDLLFMTEEERMKMTIHPYVRPVIEVIET
IPVHDLLIKMQRERIHMAILSDEYGGTSGLVTTEDILEEIVGEIRDEFDEDEQPLIQKLG
DGHYVMDGKVRIDQVNSLLGASIQEDVDTIGGLILKENIDIEAGESIRIGSYTIKVLKMD
GRLIKQIDIKEEAGNTTGITAHHKLPLPEPVMLNSATLSEK
Download sequence
Identical sequences A0A164T0N3 A0A1B2AUD6 L8AD20 O07589
gi|470161119|ref|YP_007532894.1| NP_388840.1.22788 WP_003245822.1.11257 WP_003245822.1.1140 WP_003245822.1.12759 WP_003245822.1.15902 WP_003245822.1.16291 WP_003245822.1.19261 WP_003245822.1.27372 WP_003245822.1.27660 WP_003245822.1.2914 WP_003245822.1.32219 WP_003245822.1.32420 WP_003245822.1.33846 WP_003245822.1.36189 WP_003245822.1.39605 WP_003245822.1.40859 WP_003245822.1.44140 WP_003245822.1.44184 WP_003245822.1.45019 WP_003245822.1.47157 WP_003245822.1.56274 WP_003245822.1.56411 WP_003245822.1.57201 WP_003245822.1.5726 WP_003245822.1.57513 WP_003245822.1.6139 WP_003245822.1.6517 WP_003245822.1.65223 WP_003245822.1.72999 WP_003245822.1.76977 WP_003245822.1.78686 WP_003245822.1.81116 WP_003245822.1.81747 WP_003245822.1.82722 WP_003245822.1.88042 WP_003245822.1.91723 WP_003245822.1.93420 WP_003245822.1.94199 WP_003245822.1.96043 WP_003245822.1.979 APC62029 GO.5 gi|402775182|ref|YP_006629126.1| gi|16078024|ref|NP_388840.1| gi|560127992|ref|YP_008829133.1| 224308.BSU09590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]